KEGG   Sus scrofa (pig): 396633
Entry
396633            CDS       T01009                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04071  Sphingolipid signaling pathway
ssc04115  p53 signaling pathway
ssc04141  Protein processing in endoplasmic reticulum
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04215  Apoptosis - multiple species
ssc04217  Necroptosis
ssc04722  Neurotrophin signaling pathway
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    396633 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    396633 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    396633 (BAX)
   04215 Apoptosis - multiple species
    396633 (BAX)
   04217 Necroptosis
    396633 (BAX)
   04115 p53 signaling pathway
    396633 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    396633 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    396633 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396633 (BAX)
   05202 Transcriptional misregulation in cancer
    396633 (BAX)
   05203 Viral carcinogenesis
    396633 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    396633 (BAX)
   05212 Pancreatic cancer
    396633 (BAX)
   05225 Hepatocellular carcinoma
    396633 (BAX)
   05226 Gastric cancer
    396633 (BAX)
   05214 Glioma
    396633 (BAX)
   05216 Thyroid cancer
    396633 (BAX)
   05220 Chronic myeloid leukemia
    396633 (BAX)
   05217 Basal cell carcinoma
    396633 (BAX)
   05218 Melanoma
    396633 (BAX)
   05213 Endometrial cancer
    396633 (BAX)
   05224 Breast cancer
    396633 (BAX)
   05222 Small cell lung cancer
    396633 (BAX)
   05223 Non-small cell lung cancer
    396633 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    396633 (BAX)
   05014 Amyotrophic lateral sclerosis
    396633 (BAX)
   05016 Huntington disease
    396633 (BAX)
   05020 Prion disease
    396633 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    396633 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    396633 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    396633 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396633 (BAX)
   05152 Tuberculosis
    396633 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    396633 (BAX)
   05170 Human immunodeficiency virus 1 infection
    396633 (BAX)
   05161 Hepatitis B
    396633 (BAX)
   05160 Hepatitis C
    396633 (BAX)
   05164 Influenza A
    396633 (BAX)
   05162 Measles
    396633 (BAX)
   05168 Herpes simplex virus 1 infection
    396633 (BAX)
   05163 Human cytomegalovirus infection
    396633 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    396633 (BAX)
   05169 Epstein-Barr virus infection
    396633 (BAX)
   05165 Human papillomavirus infection
    396633 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    396633 (BAX)
   01524 Platinum drug resistance
    396633 (BAX)
   01522 Endocrine resistance
    396633 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssc03029]
    396633 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    396633 (BAX)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    396633 (BAX)
Transporters [BR:ssc02000]
 Other transporters
  Pores ion channels [TC:1]
   396633 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 396633
NCBI-ProteinID: XP_003127338
Ensembl: ENSSSCG00000003144
UniProt: A0A286ZTT0 A0A4X1W1A2
LinkDB
Structure
PDB: 
5UA5

Position
6
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFADGNFNWGRVVALFYFASKL
VLKALCTRVPELIRTIMGWTLDFLRDRLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggggga
gagacacctgagctgggcctggagcaggtgcctcaggatgcatctaccaagaagttgagc
gagtgtctcaagcgcattggagatgaactggacagtaacatggagctgcagaggatgatc
gcagccgtggacacggactccccccgagaagtctttttccgagtggcggccgaaatgttt
gctgacggcaacttcaactggggccgggtggtcgcgcttttctactttgccagtaaactg
gtgctcaaggccctgtgcaccagggtgcccgaactgatcaggaccatcatgggctggacg
ctggacttccttcgagatcggctgctgggctggatccaggaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagacggtgaccatcttcgtggccggagtg
ctcaccgcctcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system