KEGG   Sus scrofa (pig): 396665
Entry
396665            CDS       T01009                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 precursor
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04068  FoxO signaling pathway
ssc04144  Endocytosis
ssc04218  Cellular senescence
ssc04350  TGF-beta signaling pathway
ssc04371  Apelin signaling pathway
ssc04380  Osteoclast differentiation
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04659  Th17 cell differentiation
ssc04926  Relaxin signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05142  Chagas disease
ssc05161  Hepatitis B
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05220  Chronic myeloid leukemia
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396665 (TGFBR1)
   04350 TGF-beta signaling pathway
    396665 (TGFBR1)
   04390 Hippo signaling pathway
    396665 (TGFBR1)
   04371 Apelin signaling pathway
    396665 (TGFBR1)
   04068 FoxO signaling pathway
    396665 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    396665 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    396665 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    396665 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    396665 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    396665 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    396665 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    396665 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396665 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    396665 (TGFBR1)
   05212 Pancreatic cancer
    396665 (TGFBR1)
   05225 Hepatocellular carcinoma
    396665 (TGFBR1)
   05226 Gastric cancer
    396665 (TGFBR1)
   05220 Chronic myeloid leukemia
    396665 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    396665 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    396665 (TGFBR1)
   05161 Hepatitis B
    396665 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    396665 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    396665 (TGFBR1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     396665 (TGFBR1)
Protein kinases [BR:ssc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   396665 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 396665
NCBI-ProteinID: NP_001033728
Ensembl: ENSSSCG00000005382 ENSSSCG00000023995
Vega: OTTSUSG00000002966
UniProt: Q5CD18
LinkDB
Position
1
AA seq 503 aa
MEVAAGAPRSRLLLFVLAATATLAPEATAFQCFCHLCTKDNFTCVTDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTVGPFPGKPPSG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggaggtggcggccggtgctccgcgttcccggctgctcctcttcgtgctggcggcgacg
gccacgctggccccggaggcgacggcattccagtgtttctgccacctttgcacaaaagac
aattttacttgtgtcacagatgggctctgctttgtctccgtcacagagaccacagacaaa
gttatacacaatagcatgtgtatagctgaaattgacctaattccgcgagacaggccattt
gtatgtgcaccttcttcaaaaactgggtctgttactacaacatattgctgcaatcaggac
cattgcaataaaatagaactcccaactgttggtccttttccaggaaagccaccatctggc
cttggtcctgttgaactggcagctgtcattgctggaccagtctgctttgtctgcatctca
ctcatgttgatggtctatatctgccataaccgtacagtcattcaccatcgagtgccaaat
gaagaggatccttcattagatcgcccttttatttcagagggtactacattaaaagattta
atttatgatatgacaacatcaggttctggatcaggcttaccattgcttgttcagagaaca
attgcaagaactattgtgctacaagaaagtattggcaaaggtcgatttggagaggtttgg
cgaggaaaatggagaggagaggaagttgctgttaaaatattctcctccagggaagaacgt
tcatggttccgtgaggcagagatttatcagactgttatgttacgtcatgaaaacatcttg
ggatttatagcagcagacaataaagataatggtacatggactcagctttggttggtgtca
gattatcatgaacatggatccctttttgattacttgaatagatacacagttactgtggaa
ggaatgataaaacttgctctgtccacagcaagtggacttgcccatcttcacatggagata
gttggtacccaaggaaaaccagctattgctcatagagatttgaaatcaaagaatatcttg
gtaaaaaagaatggaacttgctgtattgcagacttaggactggcagtaagacatgattca
gccacagatacaattgatattgctccaaaccacagagtgggaacaaaaaggtacatggcc
cctgaagttctagatgattccataaatatgaaacactttgaatccttcaaacgtgctgac
atctatgcaatgggcttagtattctgggaaatagctcgacgatgttccattggtggaatt
catgaagattaccagctgccttattatgatcttgtaccttctgatccatcagttgaagaa
atgagaaaagttgtttgtgaacagaagttaaggccaaatattcctaacagatggcagagc
tgtgaagccttaagagtaatggctaaaattatgagagaatgttggtatgccaatggagca
gccaggctcacagctttgcggattaagaaaacattgtcacaactcagtcagcaggaaggc
atcaaaatgtaa

DBGET integrated database retrieval system