KEGG   Sus scrofa (pig): 396710
Entry
396710            CDS       T01009                                 

Gene name
RARB
Definition
(RefSeq) LOW QUALITY PROTEIN: retinoic acid receptor beta
  KO
K08528  retinoic acid receptor beta
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396710 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    396710 (RARB)
   05222 Small cell lung cancer
    396710 (RARB)
   05223 Non-small cell lung cancer
    396710 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    396710 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ssc03310]
    396710 (RARB)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    396710 (RARB)
Nuclear receptors [BR:ssc03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   396710 (RARB)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 396710
NCBI-ProteinID: XP_005669361
Ensembl: ENSSSCG00000011212
LinkDB
Position
13
AA seq 336 aa
MIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYE
MTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKI
VEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHN
AGFGPLTDLVFTFASQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEAL
KIYIRRRRPSKPHMFXKDLNEITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
HEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgatttacacttgtcaccgagataagaactgtgttattaataaagtcaccaggaatcga
tgccagtactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatccgtcagg
aatgacaggaacaagaaaaagaaggagccttcgaagcaggaatgcacagagagctacgaa
atgacagccgagctggacgacctcacagagaagatccgaaaagctcaccaggaaaccttc
ccctctctctgccagctgggcaagtacaccacgaattccagtgctgaccatcgagtccga
ctggacctgggcctctgggacaaattcagtgagctggccaccaagtgcattattaagatc
gtggagtttgctaaacgtctgccaggcttcaccggcttgaccatcgcagaccaaatcacc
ctgctgaaggccgcctgcctggacatcctgatccttagaatctgcaccaggtataccccg
gagcaggacaccatgacgttctcagatggcctgaccctgaaccgaacccagatgcacaat
gccgggttcggccccctgaccgaccttgtgttcaccttcgccagccagctcctgcccttg
gagatggatgacacagagacgggccttctcagcgccatctgcttgatctgtggagaccgc
caggaccttgaagaaccaacaaaagtagataaactacaagaaccactgctggaagcactg
aaaatttatatcagaaggagacgacccagcaagcctcacatgttcnncaaagatcttaat
gaaattacagatctccgcagcatcagtgctaaaggtgcagaacgtgtaattaccttgaaa
atggaaattcctggatcaatgccacctctcattcaggaaatgctggagaattctgaagga
catgaacccttgaccccaagctcaagtgggaacacagccgagcacagccccagcatctca
cccagctcagtggagaacagcggtgtcagtcagtcaccactggtgcagtag

DBGET integrated database retrieval system