KEGG   Sus scrofa (pig): 396835
Entry
396835            CDS       T01009                                 

Gene name
WAP
Definition
(RefSeq) whey acidic protein precursor
  KO
K17106  whey acidic protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    396835 (WAP)
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 396835
NCBI-ProteinID: NP_999006
Ensembl: ENSSSCG00000016731
UniProt: O46655
LinkDB
Position
18
AA seq 132 aa
MRFLTSLALALIALEAALALAPALNLPGLATCPELSSSSEDPCVISCVNDESCPQGTKCC
ARSPCSRSCTVPLLVPVPKAGRCPWVPAPLAPELCLEKNECSRDDQCRGNKKCCFSSCAM
RCLDPDTEAPLQ
NT seq 399 nt   +upstreamnt  +downstreamnt
atgcgctttcttaccagtctggccctggccctgatcgccctggaggctgccctcgcactg
gccccagccctcaatctgccagggctggccacgtgcccagagctcagctcctcctccgag
gacccctgcgtaatctcctgcgtcaacgatgagagctgtccccaaggcaccaagtgctgc
gccaggagcccctgcagccgatcctgcacggtccccctcctggtgcctgtccccaaggcc
ggccgctgcccctgggtgccggccccgctggcccctgagctctgcttggagaaaaatgag
tgctccagggacgaccagtgtaggggcaacaagaagtgctgcttcagctcgtgtgccatg
aggtgtctggaccctgacacagaggcccctcttcagtga

DBGET integrated database retrieval system