Sus scrofa (pig): 396849 Help Entry 396849            CDS       T01009                                  Gene name RHOA Definition (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ssc  Sus scrofa (pig) Pathway ssc04014   Ras signaling pathway ssc04015   Rap1 signaling pathway ssc04022   cGMP-PKG signaling pathway ssc04024   cAMP signaling pathway ssc04062   Chemokine signaling pathway ssc04071   Sphingolipid signaling pathway ssc04072   Phospholipase D signaling pathway ssc04144   Endocytosis ssc04150   mTOR signaling pathway ssc04270   Vascular smooth muscle contraction ssc04310   Wnt signaling pathway ssc04350   TGF-beta signaling pathway ssc04360   Axon guidance ssc04510   Focal adhesion ssc04520   Adherens junction ssc04530   Tight junction ssc04611   Platelet activation ssc04621   NOD-like receptor signaling pathway ssc04625   C-type lectin receptor signaling pathway ssc04660   T cell receptor signaling pathway ssc04670   Leukocyte transendothelial migration ssc04722   Neurotrophin signaling pathway ssc04810   Regulation of actin cytoskeleton ssc04921   Oxytocin signaling pathway ssc04928   Parathyroid hormone synthesis, secretion and action ssc04972   Pancreatic secretion ssc05100   Bacterial invasion of epithelial cells ssc05132   Salmonella infection ssc05133   Pertussis ssc05135   Yersinia infection ssc05152   Tuberculosis ssc05163   Human cytomegalovirus infection ssc05200   Pathways in cancer ssc05203   Viral carcinogenesis ssc05205   Proteoglycans in cancer ssc05206   MicroRNAs in cancer ssc05210   Colorectal cancer ssc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     396849 (RHOA)    04015 Rap1 signaling pathway     396849 (RHOA)    04310 Wnt signaling pathway     396849 (RHOA)    04350 TGF-beta signaling pathway     396849 (RHOA)    04072 Phospholipase D signaling pathway     396849 (RHOA)    04071 Sphingolipid signaling pathway     396849 (RHOA)    04024 cAMP signaling pathway     396849 (RHOA)    04022 cGMP-PKG signaling pathway     396849 (RHOA)    04150 mTOR signaling pathway     396849 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     396849 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     396849 (RHOA)    04520 Adherens junction     396849 (RHOA)    04530 Tight junction     396849 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     396849 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     396849 (RHOA)    04621 NOD-like receptor signaling pathway     396849 (RHOA)    04625 C-type lectin receptor signaling pathway     396849 (RHOA)    04660 T cell receptor signaling pathway     396849 (RHOA)    04670 Leukocyte transendothelial migration     396849 (RHOA)    04062 Chemokine signaling pathway     396849 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     396849 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     396849 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     396849 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     396849 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     396849 (RHOA)   09158 Development and regeneration    04360 Axon guidance     396849 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     396849 (RHOA)    05206 MicroRNAs in cancer     396849 (RHOA)    05205 Proteoglycans in cancer     396849 (RHOA)    05203 Viral carcinogenesis     396849 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     396849 (RHOA)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     396849 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     396849 (RHOA)    05135 Yersinia infection     396849 (RHOA)    05133 Pertussis     396849 (RHOA)    05152 Tuberculosis     396849 (RHOA)    05100 Bacterial invasion of epithelial cells     396849 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     396849 (RHOA) Membrane trafficking [BR:ssc04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     396849 (RHOA) Exosome [BR:ssc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    396849 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    396849 (RHOA)   Exosomal proteins of colorectal cancer cells    396849 (RHOA)   Exosomal proteins of bladder cancer cells    396849 (RHOA) GTP-binding proteins [BR:ssc04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     396849 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  396849 NCBI-ProteinID:  NP_001231366 Ensembl:  ENSSSCG00000022080 UniProt:  A0A4X1ST20 I3LVS7 LinkDB All DBs Position 13 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt ttgctcattgtctttagcaaggaccaattcccggaggtatatgtacctaccgtgtttgaa aactatgttgcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca gcaggacaggaagattatgatcgtttgaggcccctctcctacccggatactgatgttata ctgatgtgtttctctattgatagccctgatagtttagaaaacatcccagaaaaatggact ccagaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggat cttcgaaatgatgagcacacaaggcgtgagctagctaagatgaagcaggagccagtaaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gcccgacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system