KEGG   Sus scrofa (pig): 396849
Entry
396849            CDS       T01009                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04144  Endocytosis
ssc04150  mTOR signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04310  Wnt signaling pathway
ssc04350  TGF-beta signaling pathway
ssc04360  Axon guidance
ssc04510  Focal adhesion
ssc04520  Adherens junction
ssc04530  Tight junction
ssc04611  Platelet activation
ssc04621  NOD-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04660  T cell receptor signaling pathway
ssc04670  Leukocyte transendothelial migration
ssc04722  Neurotrophin signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc04921  Oxytocin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04972  Pancreatic secretion
ssc05100  Bacterial invasion of epithelial cells
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05135  Yersinia infection
ssc05152  Tuberculosis
ssc05163  Human cytomegalovirus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    396849 (RHOA)
   04015 Rap1 signaling pathway
    396849 (RHOA)
   04310 Wnt signaling pathway
    396849 (RHOA)
   04350 TGF-beta signaling pathway
    396849 (RHOA)
   04072 Phospholipase D signaling pathway
    396849 (RHOA)
   04071 Sphingolipid signaling pathway
    396849 (RHOA)
   04024 cAMP signaling pathway
    396849 (RHOA)
   04022 cGMP-PKG signaling pathway
    396849 (RHOA)
   04150 mTOR signaling pathway
    396849 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    396849 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396849 (RHOA)
   04520 Adherens junction
    396849 (RHOA)
   04530 Tight junction
    396849 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396849 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    396849 (RHOA)
   04621 NOD-like receptor signaling pathway
    396849 (RHOA)
   04625 C-type lectin receptor signaling pathway
    396849 (RHOA)
   04660 T cell receptor signaling pathway
    396849 (RHOA)
   04670 Leukocyte transendothelial migration
    396849 (RHOA)
   04062 Chemokine signaling pathway
    396849 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    396849 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    396849 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    396849 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    396849 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    396849 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    396849 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396849 (RHOA)
   05206 MicroRNAs in cancer
    396849 (RHOA)
   05205 Proteoglycans in cancer
    396849 (RHOA)
   05203 Viral carcinogenesis
    396849 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    396849 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    396849 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396849 (RHOA)
   05135 Yersinia infection
    396849 (RHOA)
   05133 Pertussis
    396849 (RHOA)
   05152 Tuberculosis
    396849 (RHOA)
   05100 Bacterial invasion of epithelial cells
    396849 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    396849 (RHOA)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    396849 (RHOA)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   396849 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   396849 (RHOA)
  Exosomal proteins of colorectal cancer cells
   396849 (RHOA)
  Exosomal proteins of bladder cancer cells
   396849 (RHOA)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    396849 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 396849
NCBI-ProteinID: NP_001231366
Ensembl: ENSSSCG00000022080
UniProt: A0A4X1ST20 I3LVS7
LinkDB
Position
13
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt
ttgctcattgtctttagcaaggaccaattcccggaggtatatgtacctaccgtgtttgaa
aactatgttgcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca
gcaggacaggaagattatgatcgtttgaggcccctctcctacccggatactgatgttata
ctgatgtgtttctctattgatagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggat
cttcgaaatgatgagcacacaaggcgtgagctagctaagatgaagcaggagccagtaaaa
ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gcccgacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system