KEGG   Sus scrofa (pig): 396859
Entry
396859            CDS       T01009                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00220  Arginine biosynthesis
ssc00330  Arginine and proline metabolism
ssc01100  Metabolic pathways
ssc04020  Calcium signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04146  Peroxisome
ssc04371  Apelin signaling pathway
ssc04926  Relaxin signaling pathway
ssc05010  Alzheimer disease
ssc05014  Amyotrophic lateral sclerosis
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05133  Pertussis
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05200  Pathways in cancer
ssc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    396859 (NOS2)
   00330 Arginine and proline metabolism
    396859 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396859 (NOS2)
   04066 HIF-1 signaling pathway
    396859 (NOS2)
   04020 Calcium signaling pathway
    396859 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    396859 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    396859 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396859 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    396859 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    396859 (NOS2)
   05014 Amyotrophic lateral sclerosis
    396859 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    396859 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    396859 (NOS2)
   05152 Tuberculosis
    396859 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    396859 (NOS2)
   05145 Toxoplasmosis
    396859 (NOS2)
   05140 Leishmaniasis
    396859 (NOS2)
   05142 Chagas disease
    396859 (NOS2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     396859 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 396859
NCBI-ProteinID: NP_001137162
Ensembl: ENSSSCG00000017755
UniProt: B8XH66
LinkDB
Position
12
AA seq 1064 aa
MTFQDTLHREAKGDLACKSKSCLGAIMNPKSLTIGPRDKPTPPDELLPQAIEFVNLYYSS
FKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFAAKQAWRNAPRCIGRIQWSNLQVFD
ARSCSTAQEMFEHICRHLRYATNNGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMP
DGTIIGDPASVEFTQLCIDLGWKPKYGRFDVVPLVLQADGRDPELFEIPPDLVLEVPMEH
PKYEWFQELELKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILE
EVGRRMGLETHKLASLWKDRAVVEINVAVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRS
RGGCPADWIWLVPPISGSITPVFHQEMLNYVLSPFYYYQVEAWKTHVWQDEKRRPRRKEI
RFKVLVKAVLFAAVLMHKTMAARVRATILFATETGRSETLARDLGALFSCAFNPKVLCMD
EYRLSRLEEEQLLLVVTSTFGNGGSPGNGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQ
FCAFAHDIDQKLSHLGASQLTPTGEGDELSGQEEAFRGWAVQTFKVACETFDVRGKHHIQ
IPKLYTSNVTWDPQLYRLVQDSEPLDLNKALSSMHAKYVFSMRLKSQQNLQSPQSSRTTL
LVELCCEGSQGPSYLPGEHLGVFPANQPALVQGILERVVDGPAPHQPVRLETLSENGSYW
VKDKRLPPCSLSQVLTYFLDITTPPTQLLLRKLAQLATDEAERQRLETLCQPSDYNKWKF
TNSPTFLEVLEEFPSLRVSASFLLSQLPILKPRYYSISSSRDRTPTEIHLTVAVLTYRTR
DGQGPLHHGVCSTWLSSLKPQDLVPCFVRSASGFQLPEDPSRPCILIGPGTGIAPFRSFW
QQRLHEAEHKGLQGGRMTLVFGCRRPDEDHLYQEEMLEMARKGVLHEVHTAYSRLPGQPK
VYVQDLLRQRLAGEVLRVLHEEQGHLYVCGDVRMARDVACTLKQLVATALTLNEEQVEDY
FFQLKSQKRYHEDIFGAVFPYEVKKEGAVGPPSDPRAPGAHGKS
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgactttccaagacacacttcaccgcgaggccaaaggggatcttgcttgcaagtccaag
tcttgcctaggagccatcatgaaccccaaaagtttgaccataggacccagggacaagcct
accccaccagacgagcttctacctcaagctattgaatttgtcaacctgtattacagctcc
ttcaaagaggcaaaaatagaggaacatctggccagggtggaagcggtaacaaaggagata
gaaacaacaggaacctatcagctgacgggagatgagctcatcttcgccgccaagcaggcc
tggcgcaacgccccgcgctgcatcgggaggatccagtggtccaacctgcaggtcttcgac
gcccggagctgttccacggcccaggaaatgttcgagcacatctgcaggcacctgcgttat
gccaccaacaatggcaacatcaggtcggccatcaccgtgttcccccagcggagcgatggg
aagcacgacttccgggtctggaacgctcagctcatccggtatgccggctaccagatgcct
gatggcaccatcataggggacccggccagcgtggagttcacccagctgtgtatcgacctg
ggctggaaacccaagtacggccgcttcgacgtggtgcctctggtcctgcaggctgatggc
cgcgaccctgagctcttcgaaatccctcctgacctcgtgctggaggtgcccatggaacac
cccaaatacgagtggttccaggagctggagctgaagtggtacgccctgccagccgtggcc
aacatgctgctcgaggtgggcggccttgagttcccagggtgccccttcaatggctggtac
atgggcacggagatcggggtccgggacttctgcgacgtccagcgctacaacatcctggag
gaagtgggcagaaggatgggcctggaaacacacaagctggcctccctctggaaagaccgc
gctgtcgtggagatcaatgtcgccgtgctccacagtttccagaagcagaacgtgaccatc
atggaccaccactcggctgcagagtccttcatgaagtacatgcagaatgagtaccggtcc
agagggggctgcccggccgactggatttggttggtccccccaatttcaggaagcatcacc
cccgtgttccaccaggagatgttaaattatgtcttgtcccctttctactactaccaggtg
gaggcctggaaaacccacgtctggcaggatgagaagcggagaccccggagaaaagagatc
cgattcaaagtcttggtcaaagccgtgctctttgccgctgtgctcatgcacaagaccatg
gccgcccgggtcagagctaccatcctctttgcaacggagacgggaagatccgaaacgctg
gcccgggacctcggcgccttgttcagctgtgccttcaaccccaaggttctctgcatggac
gagtacaggctgagccgcctggaggaggagcagctgctgctggtggtgaccagcacgttt
gggaacggaggctccccaggcaatggagagaaactgaagaagtccctcttcatgctgaaa
gaactcaccaacaagttcaggtatgctgtgttcggcctcggctccagcatgtacccccag
ttctgtgcctttgctcatgacatcgaccagaagttgtcccacctgggggcgtctcagctc
accccgaccggggaaggggacgagctcagcgggcaggaggaggccttccgaggctgggcc
gtgcaaaccttcaaggtggcctgtgagacgttcgatgtccgaggcaaacaccacattcag
atccccaagctctatacttccaatgtgacctgggacccgcagctctacaggctcgtgcag
gactcagagcctctggacctcaacaaagctctcagcagcatgcacgccaagtacgtgttc
tccatgaggctcaaatcgcagcagaatctgcagagtccgcaatccagccgcaccaccctc
ctggtggaactctgctgtgagggcagccaaggcccaagttacctgccgggagagcatctt
ggagttttcccggccaaccagccagccctggtccaaggcatcctggagcgagtggtggac
ggccctgccccccaccaacccgtgcgcctcgagaccctcagcgagaacggcagctactgg
gtcaaggacaagcggctgcccccttgctcactcagccaggtgctcacctatttcctggac
atcaccacgcccccaactcagctgctgctccgaaagctggcccagctggccacagacgag
gccgaaaggcagaggcttgagactctgtgccagccctcagactacaacaagtggaagttc
accaacagccccacgttcctggaggtgctggaggagttcccgtccctgcgggtgtctgcc
agcttcctgctctcccagctccctattctgaagccccggtactactccatcagctcctcc
agggaccgcacacccacggagatccacctcaccgtggccgtgctcacgtaccgcacccga
gatggccagggccccctgcaccacggtgtctgcagcacatggctcagcagcctgaagccc
caggacctggtgccctgctttgtgcgaagtgccagcggcttccagctccccgaggacccc
tcccgtccctgcatcctcatcgggcctggcacaggcatcgcccccttccgcagtttctgg
cagcagcggctccatgaggccgagcacaaggggctccaggggggccgcatgaccctggtg
ttcgggtgccgccgcccagatgaagaccacctctaccaggaggagatgttggagatggcc
cggaagggggtactgcacgaggtgcacacagcctattctcgtctgcctggccagcccaag
gtctatgttcaagacctcctgcggcagcggctggcgggcgaggtgctccgcgtgctccac
gaggagcaaggccacctctatgtctgcggggacgtgcgcatggcccgggatgtggcctgc
accctgaagcagctggtggccaccgccctgaccctgaatgaggagcaggtggaggactat
ttcttccagcttaagagccagaagcgctatcatgaagatatctttggtgctgtatttccc
tacgaggtgaagaaggagggggcagtggggccacccagcgatcccagagctccaggtgcc
cacgggaaaagttaa

DBGET integrated database retrieval system