KEGG   Sus scrofa (pig): 396868
Entry
396868            CDS       T01009                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04061  Viral protein interaction with cytokine and cytokine receptor
ssc04151  PI3K-Akt signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04672  Intestinal immune network for IgA production
ssc04940  Type I diabetes mellitus
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05162  Measles
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05320  Autoimmune thyroid disease
ssc05321  Inflammatory bowel disease
ssc05330  Allograft rejection
ssc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    396868 (IL2)
   04151 PI3K-Akt signaling pathway
    396868 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    396868 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    396868 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    396868 (IL2)
   04660 T cell receptor signaling pathway
    396868 (IL2)
   04658 Th1 and Th2 cell differentiation
    396868 (IL2)
   04659 Th17 cell differentiation
    396868 (IL2)
   04672 Intestinal immune network for IgA production
    396868 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396868 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    396868 (IL2)
   05321 Inflammatory bowel disease
    396868 (IL2)
   05330 Allograft rejection
    396868 (IL2)
   05332 Graft-versus-host disease
    396868 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    396868 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    396868 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    396868 (IL2)
   05162 Measles
    396868 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    396868 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    396868 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    396868 (IL2)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Interleukins
   396868 (IL2)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Haparin
  Cytokines
   396868 (IL2)
SSDB
Motif
Pfam: IL2 RnaseA
Other DBs
NCBI-GeneID: 396868
NCBI-ProteinID: NP_999026
Ensembl: ENSSSCG00000009088
Vega: OTTSUSG00000001438
UniProt: P26891 A8D5G2
LinkDB
Position
8
AA seq 154 aa
MYKMQLLCCIALTLALMANGAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRML
TFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGS
ETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtataagatgcagctcttgtgttgcattgcactaacccttgcactcatggcaaacggt
gcacctacttcaagctctacaaagaacacaaagaaacaactggagccattgctgctggat
ttacagttgcttttgaaggaagttaagaattacgagaatgctgatctctccaggatgctc
acatttaaattttacatgcccaagcaggctacagaattgaaacaccttcagtgtttagta
gaagaactcaaagctctggagggagtgctaaatttaggtcaaagcaaaaactctgactca
gcaaatatcaaggaatcaatgaacaatatcaacgtaacagttttggaactaaagggatct
gaaacaagtttcaaatgtgaatatgatgatgagacagtaactgctgttgaatttctgaac
aaatggattaccttttgtcaaagcatctactcaacactgacttga

DBGET integrated database retrieval system