KEGG   Sus scrofa (pig): 396913
Entry
396913            CDS       T01009                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04024  cAMP signaling pathway
ssc04137  Mitophagy - animal
ssc04210  Apoptosis
ssc04310  Wnt signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04530  Tight junction
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04912  GnRH signaling pathway
ssc04915  Estrogen signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05030  Cocaine addiction
ssc05031  Amphetamine addiction
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05135  Yersinia infection
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05161  Hepatitis B
ssc05162  Measles
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05224  Breast cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05321  Inflammatory bowel disease
ssc05323  Rheumatoid arthritis
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396913 (JUN)
   04012 ErbB signaling pathway
    396913 (JUN)
   04310 Wnt signaling pathway
    396913 (JUN)
   04668 TNF signaling pathway
    396913 (JUN)
   04024 cAMP signaling pathway
    396913 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    396913 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    396913 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396913 (JUN)
   04530 Tight junction
    396913 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    396913 (JUN)
   04621 NOD-like receptor signaling pathway
    396913 (JUN)
   04625 C-type lectin receptor signaling pathway
    396913 (JUN)
   04660 T cell receptor signaling pathway
    396913 (JUN)
   04658 Th1 and Th2 cell differentiation
    396913 (JUN)
   04659 Th17 cell differentiation
    396913 (JUN)
   04657 IL-17 signaling pathway
    396913 (JUN)
   04662 B cell receptor signaling pathway
    396913 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    396913 (JUN)
   04915 Estrogen signaling pathway
    396913 (JUN)
   04921 Oxytocin signaling pathway
    396913 (JUN)
   04926 Relaxin signaling pathway
    396913 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    396913 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    396913 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396913 (JUN)
   05203 Viral carcinogenesis
    396913 (JUN)
   05231 Choline metabolism in cancer
    396913 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    396913 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    396913 (JUN)
   05211 Renal cell carcinoma
    396913 (JUN)
   05224 Breast cancer
    396913 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    396913 (JUN)
   05321 Inflammatory bowel disease
    396913 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    396913 (JUN)
   05031 Amphetamine addiction
    396913 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    396913 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    396913 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    396913 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396913 (JUN)
   05135 Yersinia infection
    396913 (JUN)
   05133 Pertussis
    396913 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    396913 (JUN)
   05170 Human immunodeficiency virus 1 infection
    396913 (JUN)
   05161 Hepatitis B
    396913 (JUN)
   05171 Coronavirus disease - COVID-19
    396913 (JUN)
   05162 Measles
    396913 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    396913 (JUN)
   05169 Epstein-Barr virus infection
    396913 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    396913 (JUN)
   05142 Chagas disease
    396913 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    396913 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    396913 (JUN)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    396913 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 NBP1 TFIIA FlaC_arch DUF3450 Fib_alpha Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 396913
NCBI-ProteinID: NP_999045
Ensembl: ENSSSCG00000030839
Vega: OTTSUSG00000001519
UniProt: P56432
LinkDB
Position
6
AA seq 331 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAQDSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQQPPQPPHHLPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 996 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggtgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg
aacctggctgacccggtgggcaacctgaagccgcacctacgggcccaggactcggacctc
ctcacctcgcccgacgtggggttgctcaagctggcgtcgcccgaactcgagcgcctgata
atccagtccagtaacgggcacatcaccaccacgccgacccctacccagttcctatgcccc
aagaacgtgactgacgagcaggagggcttcgccgaggggttcgtgcgcgcgctggccgaa
ctgcacagccagaacactctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg
ggcctggtggctccggcggtagcttcagtggcgggcggcagcggcagcggcggcttcagc
gccagcctacacagcgagccgccagtctacgctaatctcagcaacttcaaccccggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggcgggcctggcctttcccgctcag
ccccagcagcagcaacagcaaccaccgcagccgccgcaccacctgcccgtgcagcacccc
cgtctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggggaaacaccg
cccctgtctcccatcgacatggagtcgcaggagcggatcaaggcggagaggaagcgtatg
aggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatcgcccggctg
gaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccaccgccaacatg
ctcagggaacaggtggcccagcttaaacaaaaagtcatgaaccacgttaacagtgggtgc
caactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system