KEGG   Sus scrofa (pig): 396945
Entry
396945            CDS       T01009                                 

Gene name
SERPINE1
Definition
(RefSeq) plasminogen activator inhibitor 1 precursor
  KO
K03982  plasminogen activator inhibitor 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04066  HIF-1 signaling pathway
ssc04115  p53 signaling pathway
ssc04218  Cellular senescence
ssc04371  Apelin signaling pathway
ssc04390  Hippo signaling pathway
ssc04610  Complement and coagulation cascades
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    396945 (SERPINE1)
   04371 Apelin signaling pathway
    396945 (SERPINE1)
   04066 HIF-1 signaling pathway
    396945 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    396945 (SERPINE1)
   04218 Cellular senescence
    396945 (SERPINE1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    396945 (SERPINE1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    396945 (SERPINE1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    396945 (SERPINE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    396945 (SERPINE1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    396945 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    396945 (SERPINE1)
Peptidases and inhibitors [BR:ssc01002]
 Peptidase inhibitors
  Family I4: serpin family
   396945 (SERPINE1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396945 (SERPINE1)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   396945 (SERPINE1)
SSDB
Motif
Pfam: Serpin LexA_DNA_bind
Other DBs
NCBI-GeneID: 396945
NCBI-ProteinID: NP_999075
UniProt: P79335
LinkDB
Position
3
AA seq 402 aa
MRMSLVFACLAMGLALTFAEGSASSHHQSLAARLATDFGVKVFRQVVQASKDRNVVFSPY
GVASVLAMLQLTTAGDTQQQIQEAMQFKIEEKGMAPALRQLYKELMGPWNKDEISTADAI
FVQRDLKLVQGFMPYFFRLFRTTVKQVDFSEMDRARFIINDWVKRHTKGMINDLLGQGAV
DQLTRLVLVNALYFNGQWKTPFPEKSTHHRLFHKSDGSTVSVPMMAQTNKFNYTEFSTPD
GHYYDILELPYHGNTLSMFIAAPYEKEVPLSALTSILDAQLISQWKGNMTRLTRLLVLPK
FSLESEVDLRRPLENLGMTDMFRPNQADFSSLSDQELLYMSQALQKVKIEVNESGTVASS
STAIIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcggatgtcgctggtctttgcctgcctagcgatgggcctggcccttacctttgccgaa
ggctctgcctcctcccatcaccagtctctggcagcccgcctggccacagactttggagtg
aaggtgtttcggcaggtggtacaggcctccaaggaccgcaacgtggttttctcaccctat
ggggtggcctccgtcctggccatgctgcagctgaccacggcgggagacacccagcagcag
atccaagaggccatgcagttcaagattgaggagaagggcatggcccctgccctccgtcaa
ctgtacaaggagctcatggggccgtggaacaaagatgagatcagcacggccgatgccatc
ttcgtgcagcgggatctgaagctggtccagggtttcatgccctacttcttcaggctgttc
cggaccacggtcaagcaggtggatttttcagagatggacagagccaggttcatcatcaat
gactgggtgaagagacacacaaaaggcatgatcaatgacttacttggccaaggggctgtg
gaccagctgacgcgcctggttctggtgaatgccctctacttcaacggccagtggaaaacg
cccttcccagagaaaagcactcaccaccgcctcttccacaagtctgatggcagcaccgtc
tctgtgcccatgatggctcagaccaacaagttcaactacactgagttttccacccccgac
ggccattactacgacatcctggaattgccctaccacggcaacactctgagcatgttcatt
gccgccccctacgaaaaagaggtgcctctctccgccctcaccagcattctggacgctcag
ctcatcagccagtggaaagggaatatgaccagactcacccgcctcctggttctgcccaag
ttctccctggagagtgaagttgacctcaggaggcccctggagaacttgggaatgacggat
atgtttaggcctaaccaggcggacttctcaagtctttcagatcaagagcttctgtacatg
tcgcaggccctgcaaaaggtgaagatcgaggtgaatgagagcggcacggtggcatcctcc
tctacggccattatcgtctcagcccgcatggcccccgaggagatcatcatggaccggccc
ttcctgttcgtggtgcggcacaaccccacaggaacggtccttttcatgggccaagtgatg
gagccttga

DBGET integrated database retrieval system