KEGG   Sus scrofa (pig): 396985
Entry
396985            CDS       T01009                                 

Gene name
PLAU
Definition
(RefSeq) urokinase-type plasminogen activator precursor
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04064  NF-kappa B signaling pathway
ssc04610  Complement and coagulation cascades
ssc05202  Transcriptional misregulation in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    396985 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    396985 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    396985 (PLAU)
   05206 MicroRNAs in cancer
    396985 (PLAU)
   05205 Proteoglycans in cancer
    396985 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    396985 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    396985 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    396985 (PLAU)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     396985 (PLAU)
Peptidases and inhibitors [BR:ssc01002]
 Serine peptidases
  Family S1: chymotrypsin family
   396985 (PLAU)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   396985 (PLAU)
SSDB
Motif
Pfam: Trypsin Kringle Trypsin_2 DUF316 DUF1986
Other DBs
NCBI-GeneID: 396985
NCBI-ProteinID: NP_999110
Ensembl: ENSSSCG00000010312
UniProt: P04185
LinkDB
Position
14
AA seq 442 aa
MRVLRACLSLCVLVVSDSKGSHELHQESGASNCGCLNGGKCVSYKYFSNIQRCSCPKKFQ
GEHCEIDTSQTCFEGNGHSYRGKANTNTGGRPCLPWNSATVLLNTYHAHRPDALQLGLGK
HNYCRNPDNQRRPWCYVQVGLKQLVQECMVPNCSGGESHRPAYDGKNPFSTPEKVEFQCG
QKALRPRFKIVGGKSTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINY
QHKEDYIVYLGRQTLHSSTHGEMKFEVEKLILHEDYSADSLAHHNDIALLKIRTDKGQCA
QPSRSIQTICLPPVNGDAHFGASCEIVGFGKEDPSDYLYPEQLKMTVVKLVSHRECQQPH
YYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSTQGRLTLTGIVSWGRECAMKDKPGVY
TRVSRFLTWIHTHVGGENGLAH
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgagagtcctgcgggcgtgcctgtccctctgtgtcctggtcgtgagcgactccaaaggc
agccatgaacttcatcaagagtctggtgcatcgaactgtggctgtctgaatggaggaaaa
tgtgtgtcctacaagtacttctccaacattcagcgatgcagctgcccaaagaaattccaa
ggggagcactgtgagatagacacatcgcaaacctgctttgaggggaacggtcactcttac
agagggaaggccaataccaacactggaggccggccctgcctgccctggaactctgccact
gtccttctgaacacgtaccatgcccacagacctgacgccctgcagctgggcctggggaaa
cacaattactgcaggaacccagacaatcagagaagaccctggtgctacgtgcaggttggc
ctgaagcagcttgtccaagagtgcatggtgcccaactgctctggtggtgagagtcaccgg
cctgcttatgatggaaaaaatcccttctctactccggaaaaagtagagtttcagtgtggc
cagaaggctctgaggccccgctttaagattgttgggggaaaaagcaccaccatcgagaac
cagccttggtttgcagccatctatagaaggcatcgtggaggctctgtcacctatgtgtgt
ggtggcagcctcatcagtccctgctgggtggtcagcgccacccactgcttcatcaattac
caacataaggaagactacattgtctacctgggtcggcaaacccttcactccagcactcat
ggggagatgaaatttgaggtggaaaagctcatcttgcatgaggactacagtgctgacagc
cttgctcaccacaatgatattgccttgctgaagatccgtaccgacaagggccagtgtgca
cagccatcccgctccatacagaccatctgcctgcccccagtgaatggcgatgcccatttt
ggcgcaagctgtgaaatcgtcggctttggaaaagaagatccctctgactacctctatcca
gagcagctgaaaatgactgttgtgaagctagtttcccaccgggagtgtcagcagccccat
tactacggcagcgaagtcaccaccaaaatgctgtgtgctgctgacccacagtggaaaacg
gattcctgccagggagactccggggggccactggtctgctccacccaaggccgcctgact
ctgactgggattgtgagctggggccgtgaatgtgccatgaaggacaaacccggcgtctac
acaagggtctcacgcttcctgacctggatccacactcatgttgggggagagaatggccta
gcccactga

DBGET integrated database retrieval system