Sus scrofa (pig): 397036 Entry 397036            CDS       T01009                                  Gene name SOD1 Definition (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism ssc  Sus scrofa (pig) Pathway ssc04146   Peroxisome ssc04213   Longevity regulating pathway - multiple species ssc05014   Amyotrophic lateral sclerosis (ALS) ssc05016   Huntington disease ssc05020   Prion diseases Brite KEGG Orthology (KO) [BR:ssc00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     397036 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     397036 (SOD1)  09160 Human Diseases   09164 Neurodegenerative diseases    05014 Amyotrophic lateral sclerosis (ALS)     397036 (SOD1)    05016 Huntington disease     397036 (SOD1)    05020 Prion diseases     397036 (SOD1) Enzymes [BR:ssc01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      397036 (SOD1) SSDB Motif Pfam:  Sod_Cu Other DBs NCBI-GeneID:  397036 NCBI-ProteinID:  NP_001177351 Ensembl:  ENSSSCG00000021355 UniProt:  P04178 D9D839 LinkDB Position 13 AA seq 153 aa MATKAVCVLKGDGPVQGTIYFELKGEKTVLVTGTIKGLAEGDHGFHVHQFGDNTQGCTSA GPHFNPESKKHGGPKDQERHVGDLGNVTAGKDGVATVYIEDSVIALSGDHSIIGRTMVVH EKPDDLGRGGNEESTKTGNAGSRLACGVIGITQ NT seq 462 nt   +upstreamnt  +downstreamnt atggcgacgaaggccgtgtgtgtgctgaagggcgacggcccggtgcagggcaccatctac ttcgagctgaagggagagaagacagtgttagtaacgggaaccattaaaggactggctgaa ggtgatcatggattccatgtccatcagtttggagataatacacaaggctgtaccagtgca ggtcctcacttcaatcctgaatccaaaaaacatggtgggccaaaggatcaagagaggcac gttggagacctgggcaatgtgactgctggcaaagatggtgtggccactgtgtacatcgaa gattctgtgatcgccctctcgggagaccattccatcattggccgcacaatggtggtccat gaaaaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagacgggaaatgct ggaagtcgtttggcctgtggtgtaattgggatcacccagtaa

DBGET integrated database retrieval system