KEGG   Sus scrofa (pig): 397070
Entry
397070            CDS       T01009                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor precursor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04144  Endocytosis
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04520  Adherens junction
ssc04540  Gap junction
ssc04630  JAK-STAT signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc04912  GnRH signaling pathway
ssc04915  Estrogen signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397070 (EGFR)
   04012 ErbB signaling pathway
    397070 (EGFR)
   04014 Ras signaling pathway
    397070 (EGFR)
   04015 Rap1 signaling pathway
    397070 (EGFR)
   04630 JAK-STAT signaling pathway
    397070 (EGFR)
   04066 HIF-1 signaling pathway
    397070 (EGFR)
   04068 FoxO signaling pathway
    397070 (EGFR)
   04020 Calcium signaling pathway
    397070 (EGFR)
   04072 Phospholipase D signaling pathway
    397070 (EGFR)
   04151 PI3K-Akt signaling pathway
    397070 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    397070 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    397070 (EGFR)
   04520 Adherens junction
    397070 (EGFR)
   04540 Gap junction
    397070 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    397070 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    397070 (EGFR)
   04915 Estrogen signaling pathway
    397070 (EGFR)
   04921 Oxytocin signaling pathway
    397070 (EGFR)
   04926 Relaxin signaling pathway
    397070 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    397070 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397070 (EGFR)
   05206 MicroRNAs in cancer
    397070 (EGFR)
   05205 Proteoglycans in cancer
    397070 (EGFR)
   05230 Central carbon metabolism in cancer
    397070 (EGFR)
   05231 Choline metabolism in cancer
    397070 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    397070 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397070 (EGFR)
   05212 Pancreatic cancer
    397070 (EGFR)
   05225 Hepatocellular carcinoma
    397070 (EGFR)
   05226 Gastric cancer
    397070 (EGFR)
   05214 Glioma
    397070 (EGFR)
   05218 Melanoma
    397070 (EGFR)
   05219 Bladder cancer
    397070 (EGFR)
   05215 Prostate cancer
    397070 (EGFR)
   05213 Endometrial cancer
    397070 (EGFR)
   05224 Breast cancer
    397070 (EGFR)
   05223 Non-small cell lung cancer
    397070 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    397070 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    397070 (EGFR)
   05171 Coronavirus disease - COVID-19
    397070 (EGFR)
   05163 Human cytomegalovirus infection
    397070 (EGFR)
   05165 Human papillomavirus infection
    397070 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    397070 (EGFR)
   01522 Endocrine resistance
    397070 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    397070 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    397070 (EGFR)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     397070 (EGFR)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   397070 (EGFR)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   397070 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   397070 (EGFR)
  Exosomal proteins of bladder cancer cells
   397070 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 397070
NCBI-ProteinID: NP_999172
Ensembl: ENSSSCG00000022126 ENSSSCG00000023985
UniProt: Q8MIL8
LinkDB
Position
9
AA seq 1209 aa
MRRSWAGGAALLALLAAHFQASPALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQNSYNLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPMRNLQEILQGAVRFSNNPALCHAESIQWRDIVNSDFLSNMSMDF
QSQLGSCPKCDPGCLNGSCWGAGKENCQKLTKVICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRRFRDEATCKDTCPPLMLYNPTTYQMDVNPLGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSYEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFRGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPENRTGLHAF
ENLEIIRGRTKQHGQFSLAVVGLDIASLGLRSLKEISDGDVIVSGNRNLCYANTISWKKL
FGTASQKTKIINNRSEKECKAMGHICNPLCSSEGCWGPEPRDCMSCRNFSRGKECVEKCN
VLEGEPREFVENAECVQCHPECLPQAKNVTCMGRGPDSCVRCAHYIDGPHCVKTCPAGIA
GENSTLIWKFADANHVCHLCHPNCTYGCVGPGLEGCAVDRPKIPSIATGIVGGLLLAVVL
ALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWLALESILHRVYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLVPQ
QGFFHSPATSRTPLLSSLSATSSTPAVACVDRNGQSYPLKEDSFLQRYSSDPTGALTEDS
LDDTFLPAPEYVNQSVPKRPAGSVQNPVYHNQPLSAAPGRDPHYQNSHSNAVGNPEYLNT
PRPACINGGLDGPAFWAQTGSHQINLDNPDYQQAFFPKEAKSNGICKGPAAENAEYLRAA
PASSDLTGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgacgctcctgggcgggcggcgccgcgctcctggcgctgctggccgcgcacttccag
gcgagtccggcgctggaggagaagaaagtttgccaaggtacaagtaacaagctcacccag
ctgggcactttcgaagaccactttctgagcctccagaggatgttcaataactgcgaggtg
gtccttgggaacttggagatcacctacatgcagaacagctacaacctgtctttcctaaag
accattcaggaggtcgccggctacgtgctcatcgccctcaacaccgtggagaagatccct
ttggaaaacctgcagatcatccgaggaaatgtactgtatgaaaacacccatgccttagcc
gtcttatccaactacggggccaataaaaccggcctgagggagctgcccatgaggaactta
caagagatcctgcaaggcgccgtgcgcttcagcaacaaccctgccctctgtcacgcggag
tccatccagtggagggacattgtcaacagcgactttctaagcaacatgtccatggacttt
cagagccagctgggcagctgcccgaagtgtgatccaggctgtctcaatgggagctgctgg
ggtgctgggaaggagaactgccagaaattgaccaaagtcatctgtgcccagcagtgctcc
gggcgctgccgcggccggtcgcccagtgactgctgccacaaccagtgcgccgctggctgc
acggggccgcgggagagcgactgcctggtttgccgcagattccgtgacgaggccacctgc
aaggacacatgcccgccgctcatgctctacaaccccaccacctaccagatggacgtcaac
ccgctggggaagtacagctttggcgccacctgtgtcaagaagtgccctcgtaactacgtg
gtgacagaccatggctcctgtgtccgtgcctgcagctccgacagctacgaggtggaggag
gacggcgtccgcaagtgtaaaaagtgtgacgggccctgcggcaaagtttgtaacgggata
gggattggcgagtttaaagacacactttccataaatgctacgaatatcaagcacttcagg
aactgcacctcgatcagcggagatcttcatatcctgccggtagcatttaggggtgactcc
ttcacacgcacgccgcctctggaccccaaggaactggacatcctgaaaaccgtgaaggaa
ataacagggtttttactgattcaggcctggcctgaaaacaggactggcctccatgctttt
gagaacctggaaatcatacgtggcaggacgaagcaacatggtcagttttccctcgcggtt
gttggcctggacatagcgtccttggggytgcgctccctcaaggagatcagcgacggagac
gtgatcgtctcaggaaaccgaaacctgtgctatgcaaatacaatcagctggaaaaaacta
tttgggaccgcaagtcagaaaaccaaaattataaacaacaggagcgaaaaagagtgcaaa
gccatgggccacatctgtaacccgctgtgctcatcagagggctgctggggccctgaaccc
agagactgcatgtcctgtcgaaactttagccgcggcaaggaatgtgtggagaagtgcaac
gttctggagggggagccgagagagttcgtggagaatgccgagtgtgtgcagtgccacccg
gagtgcctgccccaggccaagaacgtgacctgcatgggacgcggaccggacagctgtgtc
cggtgtgctcactacatcgacggccctcactgtgtcaagacctgccccgcgggaatcgca
ggagaaaacagcaccctcatctggaagtttgcggatgccaaccacgtgtgtcacctgtgc
caccccaactgcacctacggctgtgtcggaccaggtctcgagggctgtgcggtggacagg
cccaagatcccgtccatcgccaccgggatagtggggggcctgcttctggccgtggtgctg
gccctgggggtcggcctctttctgcgcaggcgccacatcgtccgcaagcgcacgctgcgc
cggctgctgcaggagcgggagctggttgagcctctcacacccagtggagaagctcccaac
caagctctcttgaggatcctgaaggagacggaattcaaaaaggtcaaggtgctgggctcc
ggcgcgttcggcacggtgtacaagggcctctggatcccagaaggtgagaaggtgaaaatt
cctgtggctatcaaggaattaagagaagccacttctccaaaagccaacaaggaaattctt
gacgaagcctacgtgatggccagtgtggacaatcctcatgtgtgccgcctcctgggcatc
tgcctgacctccacggtgcagctcatcacgcagctcatgcccttcggctgcctcctggac
tacgtccgcgagcacaaggacaacatcggctcccagcacctgctcaactggtgtgtgcag
atcgcaaagggcatgaactatctggaagaccggcgcttggtgcaccgagacctggcggcc
aggaatgtgctggtgaagacaccgcagcatgtcaagatcactgactttgggctggccaag
ctgctgggcgccgaggagaaagagtaccacgcggaaggaggcaaagtgcccatcaagtgg
ctggctctagagtcaatcctgcaccgtgtatacacccaccagagtgacgtctggagctac
ggagtcaccgtttgggagctgatgacctttgggtccaagccttatgacgggatccccgcg
agtgagatctcgaccgtcctggagaagggagagcgcctcccgcagccccccatctgcacc
attgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagtcgcccaaag
ttccgtgagctgatcatcgaattctccaaaatggcccgagacccccagcgctaccttgtc
atccagggagacgagcgaatgcacttgccaagccctacggactccaacttctaccgcgcc
ctgatggacgaggaggacatggaggatgtggtggacgccgacgagtacctcgtcccccag
cagggcttcttccacagccccgccacctcccggacgccgctgctcagctctctgagcgcc
accagcagcacccccgctgtggcttgcgttgacagaaacgggcagagttatcccctcaag
gaagacagcttcctgcagcggtacagctccgaccccactggcgccctgaccgaggacagc
ctagacgacacttttctcccagcacccgaatatgtaaaccagtctgttcccaagaggccc
gcgggctccgtccagaaccctgtctaccacaatcagcctctcagtgcagctcctggccgg
gacccccactaccagaactcccacagcaatgccgtgggcaaccctgagtatctcaacacc
ccccgccccgcctgcatcaacggaggactggacggccctgccttctgggcacagacaggc
agccaccagattaatctggacaacccagactaccagcaggccttcttccccaaggaagcc
aagtcaaacggcatctgtaagggtcccgccgccgaaaacgcagagtacctaagggcggca
ccagccagcagtgaccttactggggcatga

DBGET integrated database retrieval system