KEGG   Sus scrofa (pig): 397077
Entry
397077            CDS       T01009                                 

Gene name
FOXO1
Definition
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04910  Insulin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04922  Glucagon signaling pathway
ssc04931  Insulin resistance
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    397077 (FOXO1)
   04152 AMPK signaling pathway
    397077 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    397077 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    397077 (FOXO1)
   04922 Glucagon signaling pathway
    397077 (FOXO1)
   04919 Thyroid hormone signaling pathway
    397077 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    397077 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    397077 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397077 (FOXO1)
   05202 Transcriptional misregulation in cancer
    397077 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    397077 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    397077 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    397077 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    397077 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    397077 (FOXO1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    397077 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 397077
NCBI-ProteinID: XP_020920928
Ensembl: ENSSSCG00000009370
Vega: OTTSUSG00000001450
LinkDB
Position
11
AA seq 662 aa
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGGPAANPDAAAGLPS
ASAAAVNADFMSNLSLLEESGDFQQAPGSVAAAAAAAAAVAAAAAAAATGGLCGDFQGPE
AGCLHPAPPQQPPPPGPLSQHPPVPPAAAGSLAGQPRKSSSSRRNAWGNLSYADLITKAI
ESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGK
SSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGAGDSPGSQFS
KWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSMVYPPSAA
KMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTIMQQTPCYSFAPPNTS
LNSPSPNYQKYTYGQSSMSPLPQMPMQTLQDSKSSYGGMAQYNCAAGLLKELLTSDSPPH
NDIMTPVDPGVAQPNSRVLGQNVLMGPSSVMPAYGGQASHNKMMNPSSHSHPGHAQSTSA
VNGRALPHAVNTMPHASGMNRLAQAKTALQVPLPHPMQMNALGGYSPASTCNGYGRMGLL
HQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWV
SG
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggccgaagcgccccaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtctaactcggccacctcc
agcccggcgccgtcgggtggcccagccgcgaaccccgacgctgccgcgggcctgccctcg
gcctcggcggccgctgtcaacgccgacttcatgagcaacctgagcctgctggaggagagc
ggggacttccagcaggcgcccggctccgtggcggcggcggcggcggcggcagccgcggtg
gcggcggcggccgccgctgctgccaccggggggttgtgcggggacttccagggcccagag
gcgggctgcctgcacccggcgccgccgcagcagcccccgccgcccgggccgctgtcgcag
cacccgcctgtgccccccgccgccgccgggtcgcttgccgggcagccgcgcaagagcagc
tcgtcccgccgcaacgcgtggggcaacctgtcctacgccgacctcatcaccaaggccatc
gagagctcggcagagaagcggctcacgctatcgcagatctacgagtggatggtcaagagc
gtgccctacttcaaggataagggcgacagcaacagctcggcaggctggaagaattcaatt
cgtcataatctgtccctacacagcaagttcattcgcgtgcagaatgaaggaactggaaaa
agttcctggtggatgctcaacccagagggaggcaagagtgggaaatcccccaggagaaga
gccgcctccatggacaacaacagtaaatttgccaagagccgaggccgggctgccaagaaa
aaagcatccctccagtctggccaggagggtgccggggacagcccgggatctcagttttcg
aagtggcccgccagccctggctctcacagcaacgatgactttgataactggagtacattt
cggccgcgcactagctcgaatgctagtactattagtgggaggctctctcccatcatgact
gagcaggatgaccttggagacggggatgtgcattctatggtgtacccaccctcggcggca
aagatggcttctactctgcccagtctgtctgagataagcaatcctgagaacatggagaac
cttttggataatctcaaccttctctcatcaccaacgtcattaactgtttcaacccagtct
tcaccaggcaccatcatgcagcagacgccatgctactcatttgcgccaccaaacaccagt
ctgaattcacccagccccaactaccaaaaatacacgtatggccaatccagcatgagccct
ttgccccagatgcctatgcaaacacttcaggacagcaaatcgagttacggaggcatggcc
cagtataactgtgcagcgggactcttgaaggagttacttacttccgactctcctccccat
aatgacattatgacgccagtcgatccgggggtggcccaacccaacagccgagtccttggc
cagaatgtgctgatgggccctagttcggtcatgccagcctacggcggccaggcctctcat
aacaaaatgatgaatcccagctcccacagccaccctggacacgctcagtccacgtctgcc
gtcaatgggcgtgccttgccccacgcggtgaacaccatgccccacgcctcggggatgaac
cgcctggcccaggcgaagaccgctttacaagtgcctctgccccaccccatgcagatgaac
gccctggggggctactcccccgccagcacctgcaacggctatggcaggatgggccttctc
caccaggagaagctcccgagtgacttggatggcatgttcattgagcgcttggactgtgac
atggagtccatcatccggaacgacctcatggatggagacactttggattttaactttgac
aatgtgttgcccaaccaaagcttcccacacagtgtcaagacgacgacacatagctgggtg
tcaggctaa

DBGET integrated database retrieval system