KEGG   Sus scrofa (pig): 397078
Entry
397078            CDS       T01009                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 precursor
  KO
K13375  transforming growth factor beta-1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04218  Cellular senescence
ssc04350  TGF-beta signaling pathway
ssc04380  Osteoclast differentiation
ssc04390  Hippo signaling pathway
ssc04659  Th17 cell differentiation
ssc04672  Intestinal immune network for IgA production
ssc04926  Relaxin signaling pathway
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05144  Malaria
ssc05145  Toxoplasmosis
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05220  Chronic myeloid leukemia
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05321  Inflammatory bowel disease
ssc05323  Rheumatoid arthritis
ssc05410  Hypertrophic cardiomyopathy
ssc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397078 (TGFB1)
   04350 TGF-beta signaling pathway
    397078 (TGFB1)
   04390 Hippo signaling pathway
    397078 (TGFB1)
   04068 FoxO signaling pathway
    397078 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397078 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397078 (TGFB1)
   04218 Cellular senescence
    397078 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    397078 (TGFB1)
   04672 Intestinal immune network for IgA production
    397078 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    397078 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    397078 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397078 (TGFB1)
   05205 Proteoglycans in cancer
    397078 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397078 (TGFB1)
   05212 Pancreatic cancer
    397078 (TGFB1)
   05225 Hepatocellular carcinoma
    397078 (TGFB1)
   05226 Gastric cancer
    397078 (TGFB1)
   05220 Chronic myeloid leukemia
    397078 (TGFB1)
   05211 Renal cell carcinoma
    397078 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    397078 (TGFB1)
   05321 Inflammatory bowel disease
    397078 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    397078 (TGFB1)
   05414 Dilated cardiomyopathy
    397078 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    397078 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    397078 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    397078 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397078 (TGFB1)
   05161 Hepatitis B
    397078 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397078 (TGFB1)
   05144 Malaria
    397078 (TGFB1)
   05145 Toxoplasmosis
    397078 (TGFB1)
   05140 Leishmaniasis
    397078 (TGFB1)
   05142 Chagas disease
    397078 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    397078 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397078 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397078 (TGFB1)
Chaperones and folding catalysts [BR:ssc03110]
 Intramolecular chaperones
  Others
   397078 (TGFB1)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   397078 (TGFB1)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   397078 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 397078
NCBI-ProteinID: NP_999180
Ensembl: ENSSSCG00000003017
Vega: OTTSUSG00000001966
UniProt: P07200
LinkDB
Structure
PDB: 
5VQF 3RJR

Position
6
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGDVPPGPLPEAVLALYNSTRDRVAGESVEPEPEPEADYYAKEVTRVLMLESGNQI
YDKFKGTPHSLYMLFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNDSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLTRREAIEGFRLSAHCSCDSKDNTLHVEINGFN
SGRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccttcggggctgcggctcttgccgctgctgctgccgctgctgtggctgctagtg
ctgacgcctggccggccggccgccggactgtccacctgcaagaccatcgacatggagctg
gtgaagcggaagcgcatcgaggccattcgcggccagattctgtccaagcttcggctcgcc
agccccccgagccagggggacgtgccgcccggcccgctgcctgaggccgtactggctctt
tacaacagtacccgcgaccgggtagccggggaaagtgtcgaaccggagcccgagccagag
gcggactactacgccaaggaggtcacccgcgtgctaatgctggaaagcggcaaccaaatc
tatgataaattcaagggcaccccccacagcttatatatgctgttcaacacgtcggagctc
cgggaagcggtgccggaacctgtattgctctctcgggcagagctgcgcctgctgaggctc
aagttaaaagtggagcagcacgtggagctataccagaaatacagcaatgattcctggcgc
tacctcagcaaccggctgctggcccccagtgactcaccggagtggctgtcctttgatgtc
accggagttgtgcggcagtggctgacccgcagagaggctatagagggttttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactccacgtggaaattaacgggttcaat
tctggccgccggggtgacctggccaccattcacggcatgaaccggcccttcctgctcctc
atggccaccccgctggagagggcccagcacctgcacagctcccggcaccgccgagccctg
gataccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctctacatt
gacttccggaaggacctgggctggaagtggattcatgaacccaagggctaccatgccaat
ttctgcctggggccctgtccctacatctggagcctagacactcagtacagcaaggtcctg
gctctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgccgcaggcg
ctggagccactgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgttcctgcaagtgcagctga

KEGG   Sus scrofa (pig): 397084
Entry
397084            CDS       T01009                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04218  Cellular senescence
ssc04350  TGF-beta signaling pathway
ssc04380  Osteoclast differentiation
ssc04390  Hippo signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05144  Malaria
ssc05145  Toxoplasmosis
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05220  Chronic myeloid leukemia
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05321  Inflammatory bowel disease
ssc05323  Rheumatoid arthritis
ssc05410  Hypertrophic cardiomyopathy
ssc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397084 (TGFB2)
   04350 TGF-beta signaling pathway
    397084 (TGFB2)
   04390 Hippo signaling pathway
    397084 (TGFB2)
   04068 FoxO signaling pathway
    397084 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397084 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397084 (TGFB2)
   04218 Cellular senescence
    397084 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    397084 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397084 (TGFB2)
   05206 MicroRNAs in cancer
    397084 (TGFB2)
   05205 Proteoglycans in cancer
    397084 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397084 (TGFB2)
   05212 Pancreatic cancer
    397084 (TGFB2)
   05225 Hepatocellular carcinoma
    397084 (TGFB2)
   05226 Gastric cancer
    397084 (TGFB2)
   05220 Chronic myeloid leukemia
    397084 (TGFB2)
   05211 Renal cell carcinoma
    397084 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    397084 (TGFB2)
   05321 Inflammatory bowel disease
    397084 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    397084 (TGFB2)
   05414 Dilated cardiomyopathy
    397084 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397084 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    397084 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397084 (TGFB2)
   05161 Hepatitis B
    397084 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397084 (TGFB2)
   05144 Malaria
    397084 (TGFB2)
   05145 Toxoplasmosis
    397084 (TGFB2)
   05140 Leishmaniasis
    397084 (TGFB2)
   05142 Chagas disease
    397084 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397084 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397084 (TGFB2)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   397084 (TGFB2)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   397084 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 397084
NCBI-ProteinID: XP_020919952
LinkDB
Position
10
AA seq 442 aa
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctactcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcgcagcgacgaggaatactacgcc
aaggaggtttacaaaatcgacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgtccgattt
gacgtctcagcgatggagaagaatgcttccaatttggtgaaggcagagttcagagtcttt
cgtttacaaaacccaaaagccagagtggctgaacaacggatcgaactgtatcagattctc
aaatccaaagatttaacgtctccaacccagcgctacatcgacagcaaagtcgtgaaaacg
agagcagaaggcgaatggctctccttcgacgtaacggacgcggttcacgaatggctccac
cataaagacaggaacctgggatttaagataagcttacactgtccctgctgcacctttgta
ccgtccaacaattacatcatccccaataaaagtgaggaactagaagcgcgatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctttggatgcagcctattgctttagaaat
gtgcaggataattgctgcctgcgtccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgagcctaaagggtacaatgccaacttctgtgccggggcgtgcccgtac
ctgtggagctctgacacccagcatagcagggttctcagcttatataacaccataaaccca
gaagcttctgcttccccttgctgcgtgtcccaggatttagaaccgctcactatcctctac
tacatcggcaaaacgcccaagatcgagcagctttctaacatgatcgtcaagtcttgcaaa
tgcagctaa

KEGG   Sus scrofa (pig): 397400
Entry
397400            CDS       T01009                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 precursor
  KO
K13377  transforming growth factor beta-3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04218  Cellular senescence
ssc04350  TGF-beta signaling pathway
ssc04390  Hippo signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05144  Malaria
ssc05145  Toxoplasmosis
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05220  Chronic myeloid leukemia
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05321  Inflammatory bowel disease
ssc05323  Rheumatoid arthritis
ssc05410  Hypertrophic cardiomyopathy
ssc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397400 (TGFB3)
   04350 TGF-beta signaling pathway
    397400 (TGFB3)
   04390 Hippo signaling pathway
    397400 (TGFB3)
   04068 FoxO signaling pathway
    397400 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397400 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397400 (TGFB3)
   04218 Cellular senescence
    397400 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397400 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397400 (TGFB3)
   05212 Pancreatic cancer
    397400 (TGFB3)
   05225 Hepatocellular carcinoma
    397400 (TGFB3)
   05226 Gastric cancer
    397400 (TGFB3)
   05220 Chronic myeloid leukemia
    397400 (TGFB3)
   05211 Renal cell carcinoma
    397400 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    397400 (TGFB3)
   05321 Inflammatory bowel disease
    397400 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    397400 (TGFB3)
   05414 Dilated cardiomyopathy
    397400 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397400 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    397400 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397400 (TGFB3)
   05161 Hepatitis B
    397400 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397400 (TGFB3)
   05144 Malaria
    397400 (TGFB3)
   05145 Toxoplasmosis
    397400 (TGFB3)
   05140 Leishmaniasis
    397400 (TGFB3)
   05142 Chagas disease
    397400 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397400 (TGFB3)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   397400 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 397400
NCBI-ProteinID: NP_999363
Ensembl: ENSSSCG00000002385
Vega: OTTSUSG00000000808
UniProt: P15203
LinkDB
Position
7
AA seq 409 aa
MHLQRALVVLALLNFATVSLSMSTCTTLDFDHIKRKRVEAIRGQILSKLRLTSPPDPSML
ANIPTQVLDLYNSTRELLEEVHGERGDDCTQENTESEYYAKEIYKFDMIQGLEEHNDLAV
CPKGITSKIFRFNVSSVEKNETNLFRAEFRVLRMPNPSSKRSEQRIELFQILQPDEHIAK
QRYIDGKNLPTRGAAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENI
QEVMEIKFKGVDSEDDPGRGDLGRLKKKKEHSPHLILMMIPPDRLDNPGLGAQRKKRALD
TNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSSVLG
LYNTLNPEASASPCCVPQDLEPLTILYYVGRTAKVEQLSNMVVKSCKCS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtcagcctc
tccatgtccacttgcaccaccttggacttcgaccacatcaagaggaagagggtggaagcc
attaggggacagatcttgagcaaactcaggctcaccagtccccccgatccatcgatgttg
gccaacatccccacccaggtcctggacctttacaacagcacccgggagctgctggaggag
gtgcacggggagaggggagacgactgcactcaggaaaacaccgagtcggagtactatgcc
aaggaaatctataaattcgacatgatccaggggctggaggagcacaatgatctggccgtt
tgccccaaaggaatcacctccaagattttccgcttcaacgtgtcgtcagtggagaaaaac
gaaaccaacctgttccgggcagaattccgggtcttgcggatgcccaaccccagctccaag
cgcagcgagcagaggattgagctcttccagatcctccagcccgatgagcacatagccaag
cagcgctacatcgacggcaagaacctgcccacgcggggtgccgccgagtggctgtccttc
gacgtcacagacactgtgcgtgaatggctcttgagaagagaatccaacttgggtctggaa
atcagcattcattgtccgtgtcacacctttcagcccaacggggatatcttggaaaacatt
caagaggtgatggaaatcaaattcaaaggtgtggacagtgaggatgatccgggccgtgga
gacctggggcgacttaagaagaagaaggaacacagccctcatctaatcctcatgatgatt
cctccagaccggctagacaacccaggcctgggggctcagaggaagaagcgggccctggac
accaactactgcttccgcaatttggaggagaactgctgtgtgcgccctctctacattgac
ttccgacaggatctgggctggaagtgggtccatgaacctaagggctactatgccaacttc
tgctcaggcccttgcccgtacctccgcagtgcagacacaacccacagctcggtgctgggg
ctgtacaacaccctgaaccccgaagcctcggcctctccgtgctgcgtgccccaggacctg
gagcccctgaccatcctgtactacgtcgggaggaccgccaaggtggagcagctctctaac
atggtggtgaagtcctgcaagtgcagctga

DBGET integrated database retrieval system