KEGG   Sus scrofa (pig): 397083
Entry
397083            CDS       T01009                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor precursor
  KO
K04357  epidermal growth factor
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04630  JAK-STAT signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05160  Hepatitis C
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05226  Gastric cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397083 (EGF)
   04012 ErbB signaling pathway
    397083 (EGF)
   04014 Ras signaling pathway
    397083 (EGF)
   04015 Rap1 signaling pathway
    397083 (EGF)
   04630 JAK-STAT signaling pathway
    397083 (EGF)
   04066 HIF-1 signaling pathway
    397083 (EGF)
   04068 FoxO signaling pathway
    397083 (EGF)
   04020 Calcium signaling pathway
    397083 (EGF)
   04072 Phospholipase D signaling pathway
    397083 (EGF)
   04151 PI3K-Akt signaling pathway
    397083 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    397083 (EGF)
   04540 Gap junction
    397083 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    397083 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397083 (EGF)
   05231 Choline metabolism in cancer
    397083 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    397083 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397083 (EGF)
   05212 Pancreatic cancer
    397083 (EGF)
   05226 Gastric cancer
    397083 (EGF)
   05214 Glioma
    397083 (EGF)
   05218 Melanoma
    397083 (EGF)
   05219 Bladder cancer
    397083 (EGF)
   05215 Prostate cancer
    397083 (EGF)
   05213 Endometrial cancer
    397083 (EGF)
   05224 Breast cancer
    397083 (EGF)
   05223 Non-small cell lung cancer
    397083 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    397083 (EGF)
   05165 Human papillomavirus infection
    397083 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    397083 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397083 (EGF)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   397083 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 Plasmod_Pvs28 Tr-sialidase_C
Other DBs
NCBI-GeneID: 397083
NCBI-ProteinID: NP_999185
Ensembl: ENSSSCG00000009134 ENSSSCG00000027559
UniProt: Q00968
LinkDB
Position
8
AA seq 1214 aa
MLLFLILLLPVVLKFSFVSLSAPARWNCPEGSPSGNGNATCVGPAPFLIFSHGNSIFRID
LEGTNHEQLVADAGISVLMDFHYNEERIYWVDLERQLLQRVFLNGTRQEKVCNLEKNVSG
MAINWINEELIWSNQQEGTITVTDMKGNNSRVLLSALKYPANVAVDPVERLMFWSSVVAG
SLHRADVTGVEVRLLLETSEEIAAVSLDVLDKRLFWIQYNREGGSSRICSCDYDGGSVHF
SKHLTQHNVFAMSLFGDHIFYSTWKKKTIWVANKHTGKDMVKMNLNPAFVPPGGIKVVHP
LVQPKAEGDAWASDQKLCKLRKGNCRGSMCGQEPKSHVCTCAEGYTLSQDGRKCEDVNEC
AFWNHGCTLGCENTPGSYYCTCPAGFVLLPDGKRCHQLISCPSNVSECSHDCVLTSDGPI
CFCPEDSVLEADGKTCSGCSSPDNGGCSQLCLPLSPVTWECGCFPGYDLQLDKKSCRASG
PPPFLLFANSQDIRHMHFDGTDYETLLNQQIGMVLALDHDPVENKVYFAHTALKWIERAN
MDGSQRERLFEEAVDVPEGLAIDWIGRKFYWTDRGRSLIEGSDLNGKYREIIIKEDISQP
RGIAVHPVAKRLFWTDMGTNPRIESSSLQGIGRQVIASSDLVWPSGITIDYLTDKLYWCD
AKQSVIEMSNLDGSRRQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGTNPCLHQNGGCEHICKESFGTAQCLCHEGFLKAPDGKMC
LALNGQEILAGRGKDLSDGVMPVDTLPRSRELEDNLTESQHILVAEIMVSDDEDCGAAGC
SAQARCVTEGEDATCQCLKGFAGDGNLCSDIDECELGTSVCPPTSSECINTEGGHVCRCS
EGYQGDGIHCLDIDECQLGVHTCGENATCTNTEGNYTCTCAGRPSEPGRICPDPTPPSHL
GEDGRYSVRNSYSECPPSHDGYCLHGGVCMYIEAVDSYACNCVFGYVGERCQHRDLKWWE
LRHAGLGRQWNVTVVAVCVVVLVLLLLLGLWGAHYYRTQKLLSKNPKNPYEESGRDVSGI
RPADGEAGMSSCPQPWFVVIKEHQNLRNGSQPGAPKDGLGADVGQFSSLEPGSLQPTSWR
KEPQMYMDTEQGCCIPSSSDKGSGPQGIGYSFHLPSYGARSIAVGVEKSHSLLSANPLRQ
QRAPDPPHQMELTQ
NT seq 3645 nt   +upstreamnt  +downstreamnt
atgctgctcttccttatccttctgttgccggtagttttgaaatttagttttgtcagcctc
tcagcaccagcgcgctggaactgtcctgaaggctctccctcaggaaacgggaatgccact
tgtgtgggtcctgcacccttcttaattttctcccatggaaacagtatctttaggattgac
ttggaaggaactaatcatgagcaattggtggcagatgctggaatatcagtgctcatggac
ttccattacaatgaggaaagaatctattgggtcgatctagaaagacaacttttgcaaaga
gtttttctgaatgggacaaggcaagagaaagtatgcaatctagagaaaaatgtttcagga
atggcaataaattggatcaatgaagaacttatttggtcaaatcaacaggaaggcaccatt
acagtaacagatatgaaaggaaacaattcccgtgttctcttaagcgccttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggttgatgttttggtcttcagtggtggccggc
agccttcacagggcagatgttacaggtgtggaagtgagacttctgttggagacatcagag
gaaattgcagctgtgtcattggatgtgcttgataaacggctcttttggattcagtataac
agagaaggaggcagttctcgtatttgttcctgtgattatgatggaggttctgtccatttt
agcaaacatctcacacagcacaatgtgtttgcaatgtccctttttggtgatcacatcttc
tattcaacatggaaaaagaagacaatttgggtagctaacaagcacactgggaaggatatg
gttaaaatgaacctcaatccagcatttgtaccacctggtggaattaaagtagtgcatcca
cttgttcagcccaaggcagagggtgatgcttgggcctctgatcagaaactctgcaaactg
aggaagggtaactgcagaggcagcatgtgtgggcaagagccaaagtcccacgtgtgcacg
tgtgccgagggatacactttaagccaagatggaaggaagtgtgaagatgtcaacgagtgt
gccttctggaatcatggctgtactctcgggtgtgaaaacactcctggatcctattattgc
acgtgtcctgcaggatttgttctgctccctgatgggaaacggtgtcatcaattaatttcc
tgcccaagcaatgtgtctgagtgtagccatgactgtgttctgacatcagatggtcccata
tgtttctgtcctgaagactcagtacttgaggcagatggaaaaacatgtagcggctgttca
tcacctgataatggtgggtgcagccagctctgccttcctctcagtccagtaacctgggaa
tgtggctgctttcctgggtatgacctacagttggacaaaaagagctgtagagcttcagga
ccaccaccgtttttgctgtttgccaattctcaagatattcgacacatgcattttgacgga
acagattatgaaactctgctcaaccagcaaataggaatggttttggccctagatcatgac
cctgtggaaaataaggtatactttgcccatacagccctgaaatggatagagagagctaat
atggatggttcccagcgagaaaggctttttgaggaagcagtcgatgtgccagaaggtctt
gccatagactggattggccgtaaattctattggacagacagagggagatctctcattgaa
gggagtgatttaaatggaaaataccgcgaaataatcattaaggaagacatctctcagcca
cgaggaattgctgttcatccagtggccaagagattattctggactgatatggggactaat
ccacgaattgaaagttcatcccttcaaggcattggccgacaggttatagccagctcggat
ctggtctggcccagcggaataacaattgattacttaactgacaagttgtattggtgcgat
gccaagcagtctgtgattgaaatgtccaatctggatggttcgagacgccagagacttgcc
cagaacgatgtaggtcacccatttgcggtagctgtgtttgaggatcacgtgtggttctct
gactggactatgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaacca
ggaacaaatccctgcttacaccaaaatggaggctgtgaacatatctgcaaagagagtttt
ggaactgctcagtgtttgtgtcatgaaggttttctgaaagccccagatggaaaaatgtgt
ctggctctgaatggccaagagatattggcaggtcgtgggaaagatctgagtgatggagta
atgccagtggacaccttacccagaagcagagagcttgaagataaccttacagaatctcaa
cacattctagtggctgaaatcatggtttcagatgacgaggactgcggcgctgcgggatgc
agtgcgcaggcgcggtgtgttacagagggagaggacgccacgtgtcagtgtttgaaagga
tttgctggagatggaaacctgtgttctgatatagatgagtgtgagctgggcacctcggtg
tgccctcctacctcctccgagtgcatcaataccgaaggtggtcacgtctgccgctgctcg
gaaggctaccagggagatgggatccactgtctcgatattgatgagtgccaactaggtgtg
cacacctgtggggaaaatgccacctgtacaaatacggagggaaactacacctgcacatgt
gctggccgcccctctgaacccggacggatttgccctgaccctactccaccctctcacctc
ggggaggatggccgctattctgtgagaaatagttactctgaatgcccgccgtcccacgac
gggtactgcctccacggtggtgtgtgtatgtatattgaagccgtcgacagctatgcctgc
aactgtgtttttggctacgttggcgagcgatgtcagcacagagacttgaaatggtgggag
ctgcgccacgctggcctcgggcgacagtggaacgtcacggtggtggccgtctgcgtggtg
gtgctggtcctgctgctgctcctggggctgtggggggctcactactacaggactcagaag
ctgctatcaaaaaatccaaagaatccttatgaagagtcaggcagagatgtgagtggtatc
aggcctgcagacggcgaggctgggatgtcctcttgcccccaaccttggtttgtggtgata
aaggaacatcaaaatctcaggaatgggagtcaacctggagcccccaaggacggcctggga
gcagatgttggccagttttcttccctggagcctgggtcattgcagccgacatcatggagg
aaggaaccccagatgtatatggacacagaacaaggatgctgtattccatcctccagtgat
aaaggctctggtccccagggaatagggtatagctttcatctcccctcctatggggcacgg
tccattgctgtcggggttgaaaaatcccattctctcctgtcagctaacccattacggcaa
caaagggctccagatccaccacaccaaatggagctgactcagtga

DBGET integrated database retrieval system