KEGG   Sus scrofa (pig): 397103Help
Entry
397103            CDS       T01009                                 

Gene name
PCSK1
Definition
(RefSeq) neuroendocrine convertase 1 precursor
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ssc01002]
    397103 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    397103 (PCSK1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     397103 (PCSK1)
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S8: subtilisin family
   397103 (PCSK1)
Chaperones and folding catalysts [BR:ssc03110]
 Intramolecular chaperones
  Subtilisin family
   397103 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 397103
NCBI-ProteinID: NP_999203
Ensembl: ENSSSCG00000014169
UniProt: Q28959
LinkDB All DBs
Position
2
AA seq 753 aa AA seqDB search
MERRAWTLQCTAFTLFCAWCALNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKSHPRRSRRSALHITKRLSDDDRVIWAEQQYEKERSKRSLLRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHDDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWSSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEPQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTGTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKVVDSEEEQPTQENLNESPLVSKSPSGSSVGGRREELAE
GAPSEAMLRLLQSAFSKNSAPKQSPKKSASVKLNIPYENFYEALEKLNQPSQLKDSEDSL
YNDYVDVFYNTKPYKHRDDRLLQALVDILREEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggactctgcagtgtactgctttcactctcttttgcgcttggtgt
gcattaaacagtgtaaaagcgaagaggcagtttgtgaatgaatgggcagcggagatcccc
gggggaccagaggcagcctcggccatagcggaggagctaggctatgaccttttgggtcag
ataggatcacttgaaaatcactacttattcaaacataaaagccatcctcgaagatctcga
aggagtgcccttcatatcactaagagattatctgatgatgaccgtgtgatatgggctgaa
caacagtatgaaaaagagagaagtaaacgttcacttctaagagactcagcactaaatctc
tttaatgatccgatgtggaatcagcaatggtacttgcaagatactaggatgactgcagcc
ctgcccaagctggacctccatgtgatacctgtttggcaaaaaggcataacaggcaaagga
gttgttattactgtactggatgatggcttggagtggaatcacacagacatctatgccaac
tatgatccagaggctagctatgattttaacgataatgaccatgatccatttccccgatat
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgctatgcaagca
aataatcacaagtgtggggtcggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgactgatgctatagaagccagctcaattggatttaatcctggacat
gtggatatttacagtgcaagctggggccctaatgatgatgggaaaactgtggaagggcct
ggccgactagcccagaaggcttttgaatatggtgtcaaacaggggagacaaggaaagggc
tctatcttcgtctgggcttctggaaatgggggacgtcagggagataactgtgactgtgat
gggtacacagacagcatctacaccatctccatcagcagtgcctcgcagcaaggcctatcc
ccctggtatgctgagaagtgctcctccacactggccacctcgtacagcagtggggattac
accgaccagcgaatcacgagtgctgacctgcacgatgactgcacagagacccacacaggc
acctcggcctctgcacccctggctgctggcatcttcgctctggccctggaagcaaatcca
aatctcacctggcgagatatgcaacacctggttgtctggacctctgagtatgacccactg
gcaaataatcctggatggaaaaagaatggagcaggcttgatggtgaacagtcggtttgga
tttgggttgctaaatgccaaagctctggtggatctagctgatcccaggacctggagcagt
gtgcctgagaagaaggagtgtgttgtaaaagacaatgactttgagcccagagccctgaaa
gctaatggagaagttattattgaaatcccaacaagagcttgtgaaccacaagagaatgct
atcaagtcactggaacatgtgcaatttgaagcaacaattgagtattcccgcagaggagac
ctccatgtcaccctcacttctgctgctggaaccggcactgtactgttggcagaaagagag
cgggatacatctcctaatggctttaagaattgggacttcatgtctgttcatacatgggga
gagaatcccataggcacttggactttgcgaattacagacatgtctggaagaatgcaaaat
gaaggcagaatcgtgaactggaagctgattctgcatggcacctcttcccagccagaacac
atgaaacagccccgagtgtacacgtcctacaacacggtgcagaatgatcgcagaggcgtg
gagaaggtggtggattccgaggaggagcagcccacacaggagaacctgaatgagagccct
ctggtatccaaaagccccagtggcagcagtgtggggggccgaagggaagagctggcagag
ggtgccccatctgaggccatgctccgactcctgcaaagtgctttcagcaaaaactctgcc
ccaaagcaatcaccaaagaaatctgcaagtgtgaagctcaacattccttacgaaaatttc
tatgaagccctggaaaagctgaaccaaccttctcagcttaaagactctgaggacagtctg
tataacgactatgtggatgttttctacaacacgaagccttacaagcacagggacgaccgg
ctgctacaagctctggtggacattctaagggaggaaaattaa

DBGET integrated database retrieval system