KEGG   Sus scrofa (pig): 397142
Entry
397142            CDS       T01009                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04310  Wnt signaling pathway
ssc04350  TGF-beta signaling pathway
ssc04371  Apelin signaling pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04659  Th17 cell differentiation
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05161  Hepatitis B
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05220  Chronic myeloid leukemia
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    397142 (SMAD4)
   04350 TGF-beta signaling pathway
    397142 (SMAD4)
   04390 Hippo signaling pathway
    397142 (SMAD4)
   04371 Apelin signaling pathway
    397142 (SMAD4)
   04068 FoxO signaling pathway
    397142 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397142 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    397142 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    397142 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    397142 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397142 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397142 (SMAD4)
   05212 Pancreatic cancer
    397142 (SMAD4)
   05225 Hepatocellular carcinoma
    397142 (SMAD4)
   05226 Gastric cancer
    397142 (SMAD4)
   05220 Chronic myeloid leukemia
    397142 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397142 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397142 (SMAD4)
   05161 Hepatitis B
    397142 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 397142
NCBI-ProteinID: NP_999237
Ensembl: ENSSSCG00000004524
UniProt: Q9GKQ9 A0A480EJV2
LinkDB
Position
1
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSGMLVKDEYVHDFEGQPSLATEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYPPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccaacaagtaatgatgcctgtctgagcattgta
cacagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataaccacaaatggagctcaccctagcaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggctggtcggaaaggatttcctcatgtgatttatgctcgtctctggagg
tggcctgatcttcacaaaaatgaattaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtttgtgtgaatccatatcactatgaacgagttgtatcaccagga
attgatctctcaggattaacactgcagagtaatgctccatcaggtatgttggtgaaggat
gaatatgttcatgactttgagggtcagccatcattagccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacggagacatacagcaccccagctctg
ttagctccatctgagtctaatgcgaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactagcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
caccataacagcactaccacctggactggaagtaggactgcaccatacccacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccacctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctccaatttctaatcatcctgctcct
gagtattggtgttccattgcctactttgaaatggatgttcaagtaggagagacgtttaag
gttccttcaagctgtcctattgttactgtcgatggatatgtagacccttctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagctggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccatgcagtctttgtacagagctactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatttatccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgtcagatgcagcagcaggcggctactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggcccaggatcagtaggtggaatagcccca
gctatcagtttatctgctgctgctggaatcggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaaaggctggggacctgattacccaaggcagagcatcaaggaa
acaccttgctggattgagattcacttacaccgggccctccagctcctagatgaagtactt
cataccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system