KEGG   Sus scrofa (pig): 397157
Entry
397157            CDS       T01009                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A precursor
  KO
K05448  vascular endothelial growth factor A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04370  VEGF signaling pathway
ssc04510  Focal adhesion
ssc04926  Relaxin signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05219  Bladder cancer
ssc05323  Rheumatoid arthritis
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397157 (VEGFA)
   04014 Ras signaling pathway
    397157 (VEGFA)
   04015 Rap1 signaling pathway
    397157 (VEGFA)
   04370 VEGF signaling pathway
    397157 (VEGFA)
   04066 HIF-1 signaling pathway
    397157 (VEGFA)
   04020 Calcium signaling pathway
    397157 (VEGFA)
   04151 PI3K-Akt signaling pathway
    397157 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    397157 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    397157 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397157 (VEGFA)
   05206 MicroRNAs in cancer
    397157 (VEGFA)
   05205 Proteoglycans in cancer
    397157 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    397157 (VEGFA)
   05211 Renal cell carcinoma
    397157 (VEGFA)
   05219 Bladder cancer
    397157 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    397157 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    397157 (VEGFA)
   05165 Human papillomavirus infection
    397157 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    397157 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    397157 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397157 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    397157 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397157 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397157 (VEGFA)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   397157 (VEGFA)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   397157 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF CXCXC
Other DBs
NCBI-GeneID: 397157
NCBI-ProteinID: NP_999249
Ensembl: ENSSSCG00000001695
UniProt: P49151
LinkDB
Position
7
AA seq 190 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNIAMQIMRIKPHQGQHIGEMS
FLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggagaccagaaaccccacgaagtggtg
aagttcatggacgtctaccagcgcagctactgccgtccaatcgagaccctggtggacatc
ttccaggagtaccccgatgagatcgagtacatcttcaagccgtcctgtgtgcccctgatg
cggtgcgggggctgctgcaacgacgaaggtctggagtgtgtgcccactgaggagttcaac
atcgccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatgagc
ttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcgaggcaagaaaat
ccctgtgggccttgctcggagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system