KEGG   Sus scrofa (pig): 397208
Entry
397208            CDS       T01009                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor precursor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04630  JAK-STAT signaling pathway
ssc04640  Hematopoietic cell lineage
ssc04650  Natural killer cell mediated cytotoxicity
ssc04657  IL-17 signaling pathway
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04668  TNF signaling pathway
ssc05146  Amoebiasis
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05171  Coronavirus disease - COVID-19
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
ssc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    397208 (CSF2)
   04668 TNF signaling pathway
    397208 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397208 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    397208 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    397208 (CSF2)
   04660 T cell receptor signaling pathway
    397208 (CSF2)
   04657 IL-17 signaling pathway
    397208 (CSF2)
   04664 Fc epsilon RI signaling pathway
    397208 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    397208 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    397208 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    397208 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397208 (CSF2)
   05171 Coronavirus disease - COVID-19
    397208 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    397208 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397208 (CSF2)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     397208 (CSF2)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  CSF and other factors
   397208 (CSF2)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Cytokines
   397208 (CSF2)
SSDB
Motif
Pfam: GM_CSF EF-hand_14
Other DBs
NCBI-GeneID: 397208
NCBI-ProteinID: NP_999283
Ensembl: ENSSSCG00000023737
UniProt: Q29118
LinkDB
Position
2
AA seq 144 aa
MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVV
CEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITF
KSFKDSLNKFLFTIPFDCWGPVKK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttctcctgggcactgtggtctgcagcatctccgctcccacc
cgcccacccagccctgtcacccggccctggcagcatgtggatgccatcaaagaagccctg
agccttctaaacaacagtaatgacacagcggctgtgatgaatgaaaccgtagacgtcgtc
tgtgaaatgtttgacccccaggagccgacatgcgtgcagactcgcctgaacctgtacaag
cagggcctgcggggcagcctcactaggctcaagagccccttgactctgttggccaagcac
tatgagcagcactgccccctcaccgaggaaacttcctgtgaaacccagtctatcaccttc
aaaagtttcaaagacagtctgaacaaatttctttttaccatcccctttgactgctggggg
ccagtcaaaaagtaa

DBGET integrated database retrieval system