KEGG   Sus scrofa (pig): 397227
Entry
397227            CDS       T01009                                 

Gene name
CDKN2B
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor B
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04218  Cellular senescence
ssc04350  TGF-beta signaling pathway
ssc04934  Cushing syndrome
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05222  Small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    397227 (CDKN2B)
   04068 FoxO signaling pathway
    397227 (CDKN2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397227 (CDKN2B)
   04218 Cellular senescence
    397227 (CDKN2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397227 (CDKN2B)
   05203 Viral carcinogenesis
    397227 (CDKN2B)
  09162 Cancer: specific types
   05226 Gastric cancer
    397227 (CDKN2B)
   05222 Small cell lung cancer
    397227 (CDKN2B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397227 (CDKN2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    397227 (CDKN2B)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 397227
NCBI-ProteinID: NP_999289
Ensembl: ENSSSCG00000005132
UniProt: A0A4X1WC50 Q8SPK3
LinkDB
Position
1
AA seq 131 aa
MLSGGGGDAGLANAAARGQVETVRQLLEAGADPNGLNHFGRRPIQVMMMGSARVAELLLL
HGADPNCADPATLTRPVHDAAREGFLDTLVALRRAGARLDVQDAWGRLPVDLAEERGHRD
VARFLRAAAGD
NT seq 396 nt   +upstreamnt  +downstreamnt
atgctcagtggcggcggtggagatgcgggcctggccaacgccgcggctcgggggcaagtg
gagaccgtgcgtcaacttctggaagccggtgcggatcccaatggactcaaccacttcggg
aggcgcccgatccaggtcatgatgatgggcagcgcacgtgtggcggagctgctgctgctc
catggcgcggaccccaactgcgcggaccctgccaccctcacccgaccggtgcacgacgcc
gcccgggagggcttcctggacactttggtggctctccgccgagccggggcgcggctggac
gtgcaagacgcctggggccgcctgccggtggatctggctgaggagaggggccaccgtgac
gttgcccggtttctgcgcgcggcagcgggagactga

DBGET integrated database retrieval system