KEGG   Sus scrofa (pig): 397244
Entry
397244            CDS       T01009                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc04010  MAPK signaling pathway
ssc04115  p53 signaling pathway
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04650  Natural killer cell mediated cytotoxicity
ssc04657  IL-17 signaling pathway
ssc04668  TNF signaling pathway
ssc04726  Serotonergic synapse
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05134  Legionellosis
ssc05145  Toxoplasmosis
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05222  Small cell lung cancer
ssc05416  Viral myocarditis
ssc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397244 (CASP3)
   04668 TNF signaling pathway
    397244 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    397244 (CASP3)
   04215 Apoptosis - multiple species
    397244 (CASP3)
   04115 p53 signaling pathway
    397244 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    397244 (CASP3)
   04657 IL-17 signaling pathway
    397244 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    397244 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397244 (CASP3)
   05206 MicroRNAs in cancer
    397244 (CASP3)
   05205 Proteoglycans in cancer
    397244 (CASP3)
   05203 Viral carcinogenesis
    397244 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397244 (CASP3)
   05222 Small cell lung cancer
    397244 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    397244 (CASP3)
   05161 Hepatitis B
    397244 (CASP3)
   05160 Hepatitis C
    397244 (CASP3)
   05164 Influenza A
    397244 (CASP3)
   05162 Measles
    397244 (CASP3)
   05168 Herpes simplex virus 1 infection
    397244 (CASP3)
   05163 Human cytomegalovirus infection
    397244 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    397244 (CASP3)
   05169 Epstein-Barr virus infection
    397244 (CASP3)
   05165 Human papillomavirus infection
    397244 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    397244 (CASP3)
   05133 Pertussis
    397244 (CASP3)
   05134 Legionellosis
    397244 (CASP3)
   05152 Tuberculosis
    397244 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397244 (CASP3)
   05145 Toxoplasmosis
    397244 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    397244 (CASP3)
   05012 Parkinson disease
    397244 (CASP3)
   05014 Amyotrophic lateral sclerosis
    397244 (CASP3)
   05016 Huntington disease
    397244 (CASP3)
   05020 Prion disease
    397244 (CASP3)
   05022 Pathways of neurodegeneration - multiple diseases
    397244 (CASP3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    397244 (CASP3)
   05416 Viral myocarditis
    397244 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    397244 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    397244 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    397244 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    397244 (CASP3)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     397244 (CASP3)
Peptidases and inhibitors [BR:ssc01002]
 Cysteine peptidases
  Family C14: caspase family
   397244 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 397244
NCBI-ProteinID: NP_999296
Ensembl: ENSSSCG00000015783
UniProt: Q95ND5
LinkDB
Position
15
AA seq 277 aa
MENNKTSVDSKSIKTLETKILHGSKSMDSGISLDVSYKMDYPEMGLCIIINNKNFDKNTG
MACRSGTDVDAANLRETFTNLKYEVRNKNDLTREEILELMHSVSKEDHSKRSSFICVLLS
HGEEGKIFGTNGPVDLKKLTSFFRGDCCRTLTGKPKLFIIQACRGTELDCGIETDSGTED
DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAALKQYVHKLELMHILTRVN
RKVAVEFESFSTDSTFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt   +upstreamnt  +downstreamnt
atggagaacaataaaacctccgtggattcaaaatccattaaaactttggagacaaagatc
ttacatggaagcaaatcaatggactctggaatatccttggatgtcagttacaaaatggat
tatcctgaaatgggtttatgtataataattaataataagaactttgataaaaataccgga
atggcatgtcgatctggtacagatgtggatgctgcaaatctcagggagaccttcacaaac
ttgaaatatgaagtcaggaataaaaatgatcttacacgtgaagaaattttggagttaatg
cacagtgtttctaaagaagaccatagcaaaaggagcagttttatttgcgtgcttctaagc
catggtgaagaaggaaaaatttttggaacaaatggacctgttgatctgaaaaaattaaca
agtttcttcagaggggactgctgtagaactctaactggcaaacccaaacttttcataatt
caggcctgccgaggcacagaattggactgtgggattgagacggacagtgggactgaagat
gacatggcgtgtcagaaaataccagttgaggcagacttcttgtatgcatattctacagca
cctggttactattcctggcgaaattcaaaggacggatcctggttcatccagtcactttgt
gcagcgctgaaacagtatgttcacaagcttgagcttatgcacattcttactcgggttaac
cgaaaggtagcagtagaattcgagtccttttctactgactctacttttcatgcaaagaaa
cagattccatgtattgtgtccatgctcacaaaagaactctacttttatcactag

DBGET integrated database retrieval system