KEGG   Sus scrofa (pig): 397249
Entry
397249            CDS       T01009                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin precursor
  KO
K05437  erythropoietin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04066  HIF-1 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04640  Hematopoietic cell lineage
ssc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    397249 (EPO)
   04066 HIF-1 signaling pathway
    397249 (EPO)
   04151 PI3K-Akt signaling pathway
    397249 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397249 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    397249 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397249 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397249 (EPO)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  CSF and other factors
   397249 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 397249
NCBI-ProteinID: NP_999299
Ensembl: ENSSSCG00000007673
UniProt: P49157
LinkDB
Position
3
AA seq 194 aa
MGARECPARLLLLSLLLLPLGLPVLGAPPRLICDSRVLERYILEAKEGENATMGCAESCS
FSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLH
VDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGK
LTLYTGEACRRRDR
NT seq 585 nt   +upstreamnt  +downstreamnt
atgggggcgcgcgaatgtcctgcccggctgcttctgctgtccttgctgctgcttcctctg
ggcctcccagtcctgggcgcccccccacgcctcatctgtgacagccgagtcctggagagg
tacatcttggaggccaaggagggcgaaaatgccacgatgggctgtgccgaaagctgcagc
ttcagtgagaatatcactgtcccagacaccaaggttaacttctatgcctggaagaggatg
gaggtccagcagcaggccatggaggtctggcagggtctggccctgctctcagaagccatc
ctgcagggccaggccctgttggccaactcctcccagccatctgaggccctgcagctgcat
gtggacaaagctgtcagcggcctgcgcagcctcacctccctgcttcgggcgctgggagcc
cagaaggaagccatcccccttccagacgcatccccctcctctgccaccccactccgaaca
tttgctgttgatactttgtgcaaacttttccgcaactactccaatttcctgcggggaaag
ctgacgctgtacactggagaggcctgcaggagaagggacaggtga

DBGET integrated database retrieval system