Sus scrofa (pig): 397276 Help Entry 397276            CDS       T01009                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism ssc  Sus scrofa (pig) Pathway ssc01522   Endocrine resistance ssc01524   Platinum drug resistance ssc04010   MAPK signaling pathway ssc04071   Sphingolipid signaling pathway ssc04110   Cell cycle ssc04115   p53 signaling pathway ssc04137   Mitophagy - animal ssc04151   PI3K-Akt signaling pathway ssc04210   Apoptosis ssc04211   Longevity regulating pathway ssc04216   Ferroptosis ssc04218   Cellular senescence ssc04310   Wnt signaling pathway ssc04722   Neurotrophin signaling pathway ssc04919   Thyroid hormone signaling pathway ssc05012   Parkinson disease ssc05014   Amyotrophic lateral sclerosis ssc05016   Huntington disease ssc05160   Hepatitis C ssc05161   Hepatitis B ssc05162   Measles ssc05163   Human cytomegalovirus infection ssc05165   Human papillomavirus infection ssc05166   Human T-cell leukemia virus 1 infection ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05168   Herpes simplex virus 1 infection ssc05169   Epstein-Barr virus infection ssc05200   Pathways in cancer ssc05202   Transcriptional misregulation in cancer ssc05203   Viral carcinogenesis ssc05205   Proteoglycans in cancer ssc05206   MicroRNAs in cancer ssc05210   Colorectal cancer ssc05212   Pancreatic cancer ssc05213   Endometrial cancer ssc05214   Glioma ssc05215   Prostate cancer ssc05216   Thyroid cancer ssc05217   Basal cell carcinoma ssc05218   Melanoma ssc05219   Bladder cancer ssc05220   Chronic myeloid leukemia ssc05222   Small cell lung cancer ssc05223   Non-small cell lung cancer ssc05224   Breast cancer ssc05225   Hepatocellular carcinoma ssc05226   Gastric cancer ssc05230   Central carbon metabolism in cancer ssc05417   Lipid and atherosclerosis ssc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     397276 (TP53)    04310 Wnt signaling pathway     397276 (TP53)    04071 Sphingolipid signaling pathway     397276 (TP53)    04151 PI3K-Akt signaling pathway     397276 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     397276 (TP53)   09143 Cell growth and death    04110 Cell cycle     397276 (TP53)    04210 Apoptosis     397276 (TP53)    04216 Ferroptosis     397276 (TP53)    04115 p53 signaling pathway     397276 (TP53)    04218 Cellular senescence     397276 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     397276 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     397276 (TP53)   09149 Aging    04211 Longevity regulating pathway     397276 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     397276 (TP53)    05202 Transcriptional misregulation in cancer     397276 (TP53)    05206 MicroRNAs in cancer     397276 (TP53)    05205 Proteoglycans in cancer     397276 (TP53)    05203 Viral carcinogenesis     397276 (TP53)    05230 Central carbon metabolism in cancer     397276 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     397276 (TP53)    05212 Pancreatic cancer     397276 (TP53)    05225 Hepatocellular carcinoma     397276 (TP53)    05226 Gastric cancer     397276 (TP53)    05214 Glioma     397276 (TP53)    05216 Thyroid cancer     397276 (TP53)    05220 Chronic myeloid leukemia     397276 (TP53)    05217 Basal cell carcinoma     397276 (TP53)    05218 Melanoma     397276 (TP53)    05219 Bladder cancer     397276 (TP53)    05215 Prostate cancer     397276 (TP53)    05213 Endometrial cancer     397276 (TP53)    05224 Breast cancer     397276 (TP53)    05222 Small cell lung cancer     397276 (TP53)    05223 Non-small cell lung cancer     397276 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     397276 (TP53)    05161 Hepatitis B     397276 (TP53)    05160 Hepatitis C     397276 (TP53)    05162 Measles     397276 (TP53)    05168 Herpes simplex virus 1 infection     397276 (TP53)    05163 Human cytomegalovirus infection     397276 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     397276 (TP53)    05169 Epstein-Barr virus infection     397276 (TP53)    05165 Human papillomavirus infection     397276 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     397276 (TP53)    05014 Amyotrophic lateral sclerosis     397276 (TP53)    05016 Huntington disease     397276 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     397276 (TP53)    05418 Fluid shear stress and atherosclerosis     397276 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     397276 (TP53)    01522 Endocrine resistance     397276 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ssc03000]     397276 (TP53)    03036 Chromosome and associated proteins [BR:ssc03036]     397276 (TP53)    03400 DNA repair and recombination proteins [BR:ssc03400]     397276 (TP53) Transcription factors [BR:ssc03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     397276 (TP53) Chromosome and associated proteins [BR:ssc03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      397276 (TP53) DNA repair and recombination proteins [BR:ssc03400]  Eukaryotic type   Check point factors    Other check point factors     397276 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  397276 NCBI-ProteinID:  NP_998989 Ensembl:  ENSSSCG00000017950 UniProt:  Q9TUB2 A0A1B2TT48 LinkDB All DBs Position 12:complement(52939643..52953786) Genome browser AA seq 386 aa AA seqDB search MEESQSELGVEPPLSQETFSDLWKLLPENNLLSSELSLAAVNDLLLSPVTNWLDENPDDA SRVPAPPAATAPAPAAPAPATSWPLSSFVPSQKTYPGSYDFRLGFLHSGTAKSVTCTYSP ALNKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERSSDYSDG LAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMN RRPILTIITLEDASGNLLGRNSFEVRVCACPGRDRRTEEENFLKKGQSCPEPPPGSTKRA LPTSTSSSPVQKKKPLDGEYFTLQIRGRERFEMFRELNDALELKDAQTARESGENRAHSS HLKSKKGQSPSRHKKPMFKREGPDSD NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt atggaggagtcgcagtccgagctgggcgtggagccccctctgagtcaggagacattttca gacttgtggaaactgcttcctgaaaacaacctgctgtcctctgagctctccctggcagca gtgaacgatctgctgctgtccccagtcacgaactggctggatgaaaatccagatgacgcc tccagagtgccagcgcctcctgcagcaacagcgcccgcaccagctgcccccgcaccagcc acctcctggcccctgtcgtcctttgtcccttctcagaagacctaccctggcagctatgat ttccgtctagggttcctgcattctggaacagccaagtctgtaacctgcacgtactcccct gccctcaataagctgttttgccagctggccaagacctgcccggtgcagctgtgggtcagc tcgccacccccgcctggcacccgtgtccgcgccatggccatctacaagaagtcagagtac atgaccgaggtggtgaggcgctgtccccaccatgagcgcagctctgactatagcgatggt ctggcccctccccagcatctcatccgggtggaagggaatttacgggccgagtacttggat gacagaaacacttttcgacacagcgttgtggtgccctacgagccgcccgaggtcggctct gactgtaccaccatccactacaacttcatgtgtaacagctcctgcatggggggcatgaac cggcggcccatcctcaccatcatcacactggaagatgccagtggcaacttgctgggacgg aacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcacagaggaagaa aatttcctcaagaagggccaatcttgccccgagcctccccctggcagcactaagcgagca ctgcccaccagcaccagctcctcgccagtgcaaaagaagaagccactggatggcgagtat ttcaccctccagatccgtgggcgtgaacgcttcgagatgttccgagagctgaatgacgcc ttggagctgaaggatgcccagactgcgcgggagtcgggggaaaacagggcccactccagc cacctgaagtctaagaaggggcagtctccctcccgccataaaaaaccgatgttcaagaga gaaggacctgactcagactga

DBGET integrated database retrieval system