KEGG   Sus scrofa (pig): 397297
Entry
397297            CDS       T01009                                 

Gene name
PPARD
Definition
(RefSeq) peroxisome proliferator-activated receptor delta
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03320  PPAR signaling pathway
ssc04310  Wnt signaling pathway
ssc05200  Pathways in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    397297 (PPARD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    397297 (PPARD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397297 (PPARD)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    397297 (PPARD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    397297 (PPARD)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ssc03310]
    397297 (PPARD)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    397297 (PPARD)
Nuclear receptors [BR:ssc03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   397297 (PPARD)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 397297
NCBI-ProteinID: NP_001123713
Ensembl: ENSSSCG00000001539
UniProt: A9XAM2 A0A4X1T1Q5
LinkDB
Position
7
AA seq 441 aa
MEQPPEEAPEVREEEKKKEVAEAEGGPELNGGPEHSLPSSSCTDLSQSCSPPALLDQLQM
GCDGASCGGLSMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERICKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQHNPQVADLKAFSK
HLYSAYLKNFNMTKKKARAILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFDHLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGTGFVTREFLRSIRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVSQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggagcagccgccggaggaagcccctgaggtccgggaagaggagaagaaaaaggaagtg
gcagaggccgaaggaggcccagagctcaatgggggaccagagcactcgcttccctccagc
agctgtacagatctctcccagagctgctctccacccgcgctgctggaccagctgcagatg
ggctgcgacggggcctcgtgcggtggcctcagcatggagtgccgggtgtgcggggacaag
gcatcaggcttccactacggagtccacgcttgcgaggggtgcaagggcttcttccgccgg
acaatccgcatgaagctggagtacgagaagtgtgagcggatctgcaagatccagaagaag
aaccgcaacaagtgccagtactgccgcttccagaaatgcctggcgctgggcatgtctcac
aacgccattcgctttggccggatgcccgaggcagagaaaaggaagctggtggctgggctg
acggcaaacgaggggagtcagcacaacccgcaggtggctgacctgaaggccttctccaag
cacctctacagcgcctacctgaaaaacttcaacatgaccaaaaagaaggcccgcgccatc
ctcaccggcaaggccagccacacagcgccctttgtgatccacgacatcgagacgttgtgg
caggccgagaagggcctggtgtggaagcagctggtgaatggcctgccgccctacaaggag
atcagcgtgcacgtcttctaccgctgccagtgcaccacggtggagacggtgcgcgagctg
accgagttcgccaagagcatccccagcttcgaccacctcttcctcaacgaccaggtgacc
cttctcaagtacggcgtgcacgaggccatcttcgccatgctggcctccatcgtcaataag
gatgggctgctggtggccaacggcactggttttgtcacccgcgagttcctgcgcagcatc
cgaaagcccttcagtgacatcattgagcccaagtttgagttcgctgtcaagttcaatgcc
ctggaactcgatgatagtgacctggctctcttcatcgcagccatcattctgtgtggagac
cggccaggcctcatgaacgtgtcacaggtggaggccatccaggacaccatcctgcgtgcc
ctcgagttccacctgcaggccaaccaccccgacgcccagtacctcttccccaagctgctg
cagaagatggcagacctgcggcagctggtcaccgagcacgcccagatgatgcagcggatc
aagaagaccgagaccgagacctcgctgcaccccctgctccaggagatctacaaggacatg
tactga

DBGET integrated database retrieval system