KEGG   Sus scrofa (pig): 397307
Entry
397307            CDS       T01009                                 

Gene name
CEBPA
Definition
(RefSeq) CCAAT/enhancer-binding protein alpha
  KO
K09055  CCAAT/enhancer binding protein (C/EBP), alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04932  Non-alcoholic fatty liver disease
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397307 (CEBPA)
   05202 Transcriptional misregulation in cancer
    397307 (CEBPA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    397307 (CEBPA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    397307 (CEBPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    397307 (CEBPA)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    397307 (CEBPA)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin TolA_bind_tri bZIP_Maf GAS Lipoprotein_20 Hema_stalk DivIC
Other DBs
NCBI-GeneID: 397307
NCBI-ProteinID: XP_003127063
Ensembl: ENSSSCG00000002866
UniProt: F1RNW6 A0A4X1TNP2
LinkDB
Position
6
AA seq 354 aa
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPAGGGGDFDYPGAPVGPGGAVMPG
GAHGPPPSYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDESKQLALAGLFPYQ
PPPPPPPPHSHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAA
GLPGPGGALKGLAPAHPDLRAGGGGGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAK
QRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggagtcggccgacttctacgaggcggagccgcggcccccgatgagcagccacctccag
agccccccgcacgcgcccagcagcgccgccttcggctttccccggggcgcgggccccgcg
cagcccccagccccacctgccgccccggagccgctgggcggcatctgcgaacacgagacg
tccatcgacatcagcgcctacatcgacccggccgccttcaacgacgagttcctggccgac
ctgtttcagcacagccggcagcaagagaaggccaaggcggccgcggcccccgcgggaggc
ggcggcgactttgactacccgggcgcccccgtgggccccggcggcgccgtcatgcccggg
ggggctcacggcccccctcccagctacggctgcgcggcggccggctacctggacggcagg
ctggagcccctgtacgagcgcgtcggggcgccggcgctgcggccgctagtgatcaagcag
gagccgcgcgaggaggacgagtcgaagcagctggcgctggccggcctctttccctaccag
ccaccgccgccaccgccaccaccgcattcacaccctccgcccgcacacctggccgccccg
cacttgcagttccagatcgcgcactgcggccagaccaccatgcacctgcagcccggccac
cccacgccgccgcccacgcccgtgcccagcccgcacccagcgcccgcgcttggcgccgct
ggcctgccaggccccggcggcgctctcaaggggctggccccagcgcaccccgacctgcgc
gcgggcggcggcggcggcgcaggcaaagccaagaagtcggtagacaagaacagcaacgag
taccgggtgcggcgtgagcgcaacaacatcgcggtgcgcaagagccgggacaaggccaag
cagcgcaacgtggagactcaacagaaggtgctggagctgaccagtgacaatgaccgcctg
cgcaagcgggtggaacaactgagccgcgaactggacacgctgcggggcatcttccgccag
ctgcccgagagctccctggtcaaggccatgggcaactgcgcttga

DBGET integrated database retrieval system