KEGG   Sus scrofa (pig): 397459
Entry
397459            CDS       T01009                                 

Gene name
ITGAM
Definition
(RefSeq) integrin alpha-M isoform X2
  KO
K06461  integrin alpha M
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04015  Rap1 signaling pathway
ssc04145  Phagosome
ssc04514  Cell adhesion molecules
ssc04610  Complement and coagulation cascades
ssc04613  Neutrophil extracellular trap formation
ssc04640  Hematopoietic cell lineage
ssc04670  Leukocyte transendothelial migration
ssc04810  Regulation of actin cytoskeleton
ssc05133  Pertussis
ssc05134  Legionellosis
ssc05140  Leishmaniasis
ssc05146  Amoebiasis
ssc05150  Staphylococcus aureus infection
ssc05152  Tuberculosis
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    397459 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    397459 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    397459 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    397459 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    397459 (ITGAM)
   04610 Complement and coagulation cascades
    397459 (ITGAM)
   04613  Neutrophil extracellular trap formation
    397459 (ITGAM)
   04670 Leukocyte transendothelial migration
    397459 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    397459 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    397459 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    397459 (ITGAM)
   05134 Legionellosis
    397459 (ITGAM)
   05150 Staphylococcus aureus infection
    397459 (ITGAM)
   05152 Tuberculosis
    397459 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397459 (ITGAM)
   05140 Leishmaniasis
    397459 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    397459 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    397459 (ITGAM)
   04515 Cell adhesion molecules [BR:ssc04515]
    397459 (ITGAM)
   04090 CD molecules [BR:ssc04090]
    397459 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397459 (ITGAM)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    397459 (ITGAM)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   397459 (ITGAM)
Cell adhesion molecules [BR:ssc04515]
 Integrins
  Integrin alpha subunits
   397459 (ITGAM)
CD molecules [BR:ssc04090]
 Proteins
  397459 (ITGAM)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   397459 (ITGAM)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS Integrin_alpha FG-GAP_2 DUF11
Other DBs
NCBI-GeneID: 397459
NCBI-ProteinID: XP_003124540
Ensembl: ENSSSCG00000007754
Vega: OTTSUSG00000001957
LinkDB
Position
3
AA seq 1265 aa
MFWRQVLGLVLAFPGVLADSRSRWANKDTFGMATLMVGVGKPGRQGGRPGCVQPRGRTVQ
QGCGLPEPPPSSSEYLTDFVPPTSLFRVLPAFGGFLEVAQWAPAASRFLLPPAMTHRILL
LTALALSHGFNLDTENAVVFQENANGFGQSVVQLEGSRLVVGAPQEVRAANQTGGLYQCD
YSTGTCEPIRLQVPPEAVNMSLGLSLTFATNPSRLLACGPTVHQICKENTYVNGLCFLFG
SNLHQQPQRVPETLRGCPQQESDIAFLIDGSGSINRLDFQRMKEFVSTVMGQFQKSKTLF
ALMQYSEDFYTHFTFNDFKRNPSPELLVRPIRQLLGRTHTATGIRKVVRELFHSKSGARE
NALKILVVITDGEKFGDPLGYEDVIPEADRKGVIRYVIGVGDAFNSWKSREELNTIASKP
SGDHVFQVTNFEALKTIQNQLQEKIFAIEGTQTGSTSSFEYEMSQEGFSAAITSNGPLLG
AVGSFDWAGGAFLHMPKDRVIFINTTRVDSDMNDAYLGYAVEVILRNQAQSLVLGAPRYQ
HTGLVVMFKQNSGAWEKNADIKGSQIGSYFGASLCSVDVNRDGSSDLVLIGAPHYYEQTR
GGQVSVCPLPQGRAKWQCRVILRGEQGHPWSRFGAALTALGDVNGDKLTDVAIGAPGEQD
NRGAVYLFHGTSELGISPSHSQRIAGSQLSPRLQYFGQSLSGGQDLTMDGLMDLAVGAQG
HVFLLRSQPVLRVEASMVFKPREVARNVYECRQQAAKTQIAGEVQVCLQVRKSTWDRLRE
GDTQSIITYDLALDPGRPHPRAVFEETKNNTRRQTQTLGLSRKCEHLTLWLPDCVEDSVT
PIVLRLNFSLVGKPASSFGNLRPVLAVDAQRLFTALFPFEKNCGNDSICQDDLSITFSFM
SLDTLVVGGPRDLKVTLTVRNQGEDSYRTQVTFFYPSGLSYRKVSTSQNQRSQRSWRLAC
ESDVSTEESTALKSTSCSINHPIFPDNSEVTFNVTFDVNPDAFFGYKLLLKANVTSENNM
PSSNKTEFQLELPVKYAVYVVVTSLEVSTKYFNFTASEKTRHVIEHQYQFNNLGQRKLPI
SVVFWVPVRLNRVTVWDQPQVTFSQNLSRSCSTEEIGPRHSDFLEKLQKTPVLNCSIAVC
QKIQCDIPSFGIQEELKVTLKGNLSFDWYIKTSHNHLQVVSTAEVLFNDSQFALLPGQEA
FVRAQTETKVEPYEVHNPLPLIVGSSIGGLVLLALITAGLYKLGFFKRQYKDMMSEPVPE
PAVPQ
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgttctggaggcaggtcctaggtctagtccttgcctttcctggggttttggccgactct
agaagcaggtgggcaaacaaagacacctttgggatggcgaccttgatggttggggtgggg
aagccagggaggcagggagggaggccaggctgtgtgcagccccgggggaggacggtccag
cagggctgtgggctccctgagcctccgccctcttcctctgaatatctgacagactttgtg
cctcctacttctctttttagggtccttcctgcgtttggtggcttccttgaagtggctcag
tgggcgcctgcagcctcacggttcctgctccctccagccatgactcacagaatccttctg
ctgacagccttggccttaagtcatgggttcaacctggacacggaaaatgcagtcgtcttc
caggaaaatgcaaatggcttcgggcagagcgtggtccagctggaggggtcgaggctggtg
gttggagccccccaggaggtaagggctgccaaccaaacaggtggcctctaccagtgtgac
tacagcacaggcacatgtgagcctatccgcctgcaggtgcccccagaggctgtgaacatg
tccctgggcctgtctctgacgtttgccactaatccgtcccggctgctggcctgcggccct
actgtgcaccaaatttgcaaggagaacacctatgtgaacggcctctgcttcctgtttgga
tccaacctacatcagcagccccagagggtcccagagaccctcagagggtgccctcagcaa
gagagtgacattgcctttttgattgatggttccggtagcatcaaccggttagactttcag
cggatgaaggagtttgtctccactgtgatgggtcaattccaaaagtccaaaaccttgttt
gctctgatgcagtactctgaagacttctacactcatttcaccttcaatgatttcaagaga
aacccttccccagaattgctggtgaggccaataagacagctgctggggaggactcacacc
gccacgggaatccgcaaagtagtaagagaactgtttcacagcaagagtggagcccgggag
aatgcccttaagatcctagttgtcatcacggacggagaaaagttcggcgatcctttgggg
tatgaggatgtcatccctgaagcggatagaaagggcgtcattcgctacgtcatcggggtg
ggagatgccttcaacagttggaaatctcgtgaggagcttaataccattgcatccaagccg
tctggtgatcacgtgttccaggtgactaactttgaagctctgaagaccattcagaaccag
cttcaggaaaagatctttgcgattgagggtacacagacaggaagtaccagctcctttgag
tatgagatgtctcaggaaggcttcagtgcagccatcacctctaatggtcccttgctgggc
gctgtggggagctttgactgggctggcggagcctttctgcatatgccaaaggacagagtc
attttcatcaacaccactagggtggattcagacatgaacgatgcttacttgggttatgct
gtcgaagtcatcttgcggaaccaggcgcaaagcctggtcctgggggcgcctcgatatcag
cacactggcctggtggtgatgttcaaacagaattcaggtgcctgggagaaaaatgccgac
atcaagggcagccagatcggctcctactttggggcctctctctgctccgtggacgtgaac
agagatggcagctccgacctggtcctcatcggggccccccattactatgagcagacccgg
gggggccaggtgtctgtgtgtcccttgccccaggggagggctaagtggcagtgccgggtc
attctccgcggggagcaaggccacccctggagccgctttggggcagccctgacagcgctg
ggggatgtgaatggggacaagctgacggacgtggccattggggccccgggggagcaggac
aaccggggtgctgtctacctgtttcacggaacctcggagctgggcatcagcccctcccac
agccagcggattgcaggctcccagctctccccaaggctccagtattttgggcagtccctg
agcgggggccaggacctcacgatggatggactgatggacttggctgtaggggcccaaggc
catgtgttcctgctcaggtcccagcctgtgctgagagttgaggcatcgatggtgttcaaa
cccagggaagtggcgaggaatgtgtatgagtgtcgtcaacaggcggcgaaaacccagatt
gctggcgaggtccaagtctgcctccaagttcgcaagagcacatgggaccggctgagagaa
ggagacacccagagcatcatcacatatgacctggctctggacccggggcgcccccatccc
cgggccgtctttgaggagacaaagaacaatacacgcagacagacccagacgctggggctg
agccggaaatgtgagcacctgacgctgtggttaccggattgcgtggaggactcagtgacg
cccattgtcctacgcctcaacttctctctggtgggaaagcctgcatcctcttttgggaac
ctccggccagtgctggctgttgatgctcaaagactcttcacagccttgtttcccttcgag
aagaattgcggcaatgacagcatctgccaggatgacctgagcatcaccttcagttttatg
agcctggacaccctggtggtgggtggtcctcgggacttaaaagtgaccctgaccgtgaga
aaccagggcgaggactcctacagaactcaggtcaccttcttctacccgtctggcttgtcc
tatcggaaggtgtcaacctcccagaaccaacgctcccagagatcctggcgcctggcctgt
gagtctgatgtctccactgaagagtctacggccttgaagagcacgagctgtagcataaac
caccccatcttcccggacaactcagaggtcacctttaatgtcacatttgatgtgaatcct
gatgctttttttggatacaaactccttctcaaggccaacgtgaccagtgagaacaacatg
cccagcagcaacaaaaccgaattccagctggagctgcctgtgaaatacgctgtctacgtg
gtggttaccagccttgaggtttccaccaaatatttcaacttcacagcctcggagaagacc
cgccacgtcatagagcatcagtatcagttcaacaacctgggtcagaggaagctccccatc
agtgtggtcttctgggtccccgttcggctgaaccgagtgaccgtgtgggaccagccccag
gtcaccttctcccagaacctttccaggagctgctctaccgaggagatcggcccccgtcac
tctgatttcctggagaagcttcagaagactccagtgctgaactgctccatcgctgtctgc
cagaaaatccagtgtgacatcccatccttcggcatccaggaagaactcaaggtcaccctc
aagggcaatctctcatttgactggtacatcaagacctcgcataaccaccttcaagtggtg
agcaccgcggaggtcttgtttaatgattcgcagtttgccctgctcccaggacaggaggcc
tttgtgagggcccagacagagaccaaagtggagccgtacgaagtgcataaccctctccca
ctcatcgtgggcagctcgataggggggctggtgctcctggcccttatcactgccggactg
tacaagctcggcttcttcaaacgccagtacaaggacatgatgagtgaacctgttcctgaa
cctgctgtgcctcagtaa

DBGET integrated database retrieval system