KEGG   Sus scrofa (pig): 397484
Entry
397484            CDS       T01009                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha precursor
  KO
K08774  transforming growth factor, alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04915  Estrogen signaling pathway
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397484 (TGFA)
   04012 ErbB signaling pathway
    397484 (TGFA)
   04014 Ras signaling pathway
    397484 (TGFA)
   04151 PI3K-Akt signaling pathway
    397484 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    397484 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397484 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397484 (TGFA)
   05212 Pancreatic cancer
    397484 (TGFA)
   05225 Hepatocellular carcinoma
    397484 (TGFA)
   05214 Glioma
    397484 (TGFA)
   05211 Renal cell carcinoma
    397484 (TGFA)
   05215 Prostate cancer
    397484 (TGFA)
   05223 Non-small cell lung cancer
    397484 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    397484 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 397484
NCBI-ProteinID: NP_999416
UniProt: Q06922
LinkDB
Position
3
AA seq 160 aa
MVPSAGQFALFALGILLAVCQALENSTSALSADPPIAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagttcgccctcttcgcgctgggtatcttgttggccgtgtgc
caggccctggagaacagcacgtccgccctgagtgcagacccgcccatagctgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccactctgggtacgtcggcgca
cgctgtgaacacgcagacctcctggcggtggtggccgccagccagaagaagcaggccatt
accgccttggtggtggtctccatagtggccctggctgtcctcatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagtgccctcctgaagggaaggaccgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system