KEGG   Sus scrofa (pig): 397497
Entry
397497            CDS       T01009                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04390  Hippo signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05200  Pathways in cancer
ssc05218  Melanoma
ssc05224  Breast cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397497 (FGF1)
   04014 Ras signaling pathway
    397497 (FGF1)
   04015 Rap1 signaling pathway
    397497 (FGF1)
   04390 Hippo signaling pathway
    397497 (FGF1)
   04151 PI3K-Akt signaling pathway
    397497 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    397497 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397497 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    397497 (FGF1)
   05218 Melanoma
    397497 (FGF1)
   05224 Breast cancer
    397497 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397497 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397497 (FGF1)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   397497 (FGF1)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   397497 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 397497
NCBI-ProteinID: XP_003124058
Ensembl: ENSSSCG00000024954
UniProt: A0A4X1STD1 F1RM38
LinkDB
Position
2
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggcgaaatcacaaccttcacggccctgaccgagaagtttaatctgcctcca
ggaaattacaagaagcccaagctcctctactgcagcaacgggggccatttcctcaggatc
cttccagatggcacagtggatgggaccagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtacggagactggccagtacttg
gccatggacaccagcgggcttttgtacggctcacagacacccagtgaggagtgtttgttc
ctggagaggctggaggaaaaccattacaatacctacacatccaagaagcacgcagagaag
aactggttcgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactat
ggccagaaagccatcctgtttctccccctgccagtatcctcggattaa

DBGET integrated database retrieval system