KEGG   Sus scrofa (pig): 397509
Entry
397509            CDS       T01009                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand precursor
  KO
K05461  KIT ligand
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04640  Hematopoietic cell lineage
ssc04916  Melanogenesis
ssc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397509 (KITLG)
   04014 Ras signaling pathway
    397509 (KITLG)
   04015 Rap1 signaling pathway
    397509 (KITLG)
   04072 Phospholipase D signaling pathway
    397509 (KITLG)
   04151 PI3K-Akt signaling pathway
    397509 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    397509 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    397509 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397509 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397509 (KITLG)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   397509 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 397509
NCBI-ProteinID: NP_999434
UniProt: Q29030 A0A1B2TT44
LinkDB
Position
5
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVRTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVRKSSKSPEPRLFTPEKFFGIFNRSIDAFKDLEMVAPKTSECVISSTLTPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASDSIEDSSLQWAAVALPAFFSLVIGFAFGALYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcagaactcaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgaaatggtggaacaactgtcagtcagc
ttgactgatcttctggacaagttttccaatatttctgaaggcttgagtaattattctatc
atagacaaacttgtgaaaattgttgatgacctcgtggaatgcatggaagaacactcattt
gagaatgtaagaaaatcatctaagagcccagaacccaggctgtttactcctgaaaaattc
tttgggatttttaatagatccatcgatgccttcaaggatttggagatggtggcacctaaa
actagtgaatgtgtgatttcttcaacattaactcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcagattccattgaagactccagcctccagtgggcagccgtagca
ttgccagcattcttctctcttgtcattgggtttgcttttggagccttatactggaagaag
aaacaaccaaaccttacaaggacagtggaaaatatacagattaatgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system