KEGG   Sus scrofa (pig): 397536
Entry
397536            CDS       T01009                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01524  Platinum drug resistance
ssc04014  Ras signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04115  p53 signaling pathway
ssc04137  Mitophagy - animal
ssc04140  Autophagy - animal
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04621  NOD-like receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05145  Toxoplasmosis
ssc05162  Measles
ssc05166  Human T-cell leukemia virus 1 infection
ssc05168  Herpes simplex virus 1 infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05212  Pancreatic cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05225  Hepatocellular carcinoma
ssc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    397536 (BCL2L1)
   04630 JAK-STAT signaling pathway
    397536 (BCL2L1)
   04064 NF-kappa B signaling pathway
    397536 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    397536 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    397536 (BCL2L1)
   04137 Mitophagy - animal
    397536 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    397536 (BCL2L1)
   04215 Apoptosis - multiple species
    397536 (BCL2L1)
   04115 p53 signaling pathway
    397536 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    397536 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397536 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    397536 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    397536 (BCL2L1)
   05225 Hepatocellular carcinoma
    397536 (BCL2L1)
   05220 Chronic myeloid leukemia
    397536 (BCL2L1)
   05222 Small cell lung cancer
    397536 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397536 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    397536 (BCL2L1)
   05162 Measles
    397536 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    397536 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    397536 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    397536 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    397536 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    397536 (BCL2L1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    397536 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    397536 (BCL2L1)
   01524 Platinum drug resistance
    397536 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    397536 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    397536 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    397536 (BCL2L1)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     397536 (BCL2L1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    397536 (BCL2L1)
Transporters [BR:ssc02000]
 Other transporters
  Pores ion channels [TC:1]
   397536 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 397536
NCBI-ProteinID: NP_999450
Ensembl: ENSSSCG00000007229
UniProt: O77737
LinkDB
Position
17
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttactgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagaagcggaaacccctagtgccatcaatggcaacccatcctggcacctggcg
gacagccccgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggctgcagtgaagcaagcgctgagggaggcgggcgatgagtttgaactgagg
taccggagggcattcagtgacctgacgtcccagctccacatcaccccagggacagcgtat
cagagctttgagcaggtattgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacggaaacaatgcagca
gctgagagccggaagggccaggaacgcttcaaccgatggttcctgacgggcatgactcta
gctggggtggttctgctgggttcgctcttcagtcggaaatga

DBGET integrated database retrieval system