Sus scrofa (pig): 397536 Help Entry 397536            CDS       T01009                                  Gene name BCL2L1 Definition (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ssc  Sus scrofa (pig) Pathway ssc01521   EGFR tyrosine kinase inhibitor resistance ssc01524   Platinum drug resistance ssc04014   Ras signaling pathway ssc04064   NF-kappa B signaling pathway ssc04115   p53 signaling pathway ssc04137   Mitophagy - animal ssc04140   Autophagy - animal ssc04151   PI3K-Akt signaling pathway ssc04210   Apoptosis ssc04215   Apoptosis - multiple species ssc04621   NOD-like receptor signaling pathway ssc04630   JAK-STAT signaling pathway ssc05012   Parkinson disease ssc05014   Amyotrophic lateral sclerosis ssc05022   Pathways of neurodegeneration - multiple diseases ssc05145   Toxoplasmosis ssc05162   Measles ssc05166   Human T-cell leukemia virus 1 infection ssc05168   Herpes simplex virus 1 infection ssc05170   Human immunodeficiency virus 1 infection ssc05200   Pathways in cancer ssc05202   Transcriptional misregulation in cancer ssc05212   Pancreatic cancer ssc05220   Chronic myeloid leukemia ssc05222   Small cell lung cancer ssc05225   Hepatocellular carcinoma ssc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     397536 (BCL2L1)    04630 JAK-STAT signaling pathway     397536 (BCL2L1)    04064 NF-kappa B signaling pathway     397536 (BCL2L1)    04151 PI3K-Akt signaling pathway     397536 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     397536 (BCL2L1)    04137 Mitophagy - animal     397536 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     397536 (BCL2L1)    04215 Apoptosis - multiple species     397536 (BCL2L1)    04115 p53 signaling pathway     397536 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     397536 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     397536 (BCL2L1)    05202 Transcriptional misregulation in cancer     397536 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     397536 (BCL2L1)    05225 Hepatocellular carcinoma     397536 (BCL2L1)    05220 Chronic myeloid leukemia     397536 (BCL2L1)    05222 Small cell lung cancer     397536 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     397536 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     397536 (BCL2L1)    05162 Measles     397536 (BCL2L1)    05168 Herpes simplex virus 1 infection     397536 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     397536 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     397536 (BCL2L1)    05014 Amyotrophic lateral sclerosis     397536 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     397536 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     397536 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     397536 (BCL2L1)    01524 Platinum drug resistance     397536 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ssc01009]     397536 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssc03036]     397536 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ssc02000]     397536 (BCL2L1) Protein phosphatases and associated proteins [BR:ssc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      397536 (BCL2L1) Chromosome and associated proteins [BR:ssc03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     397536 (BCL2L1) Transporters [BR:ssc02000]  Other transporters   Pores ion channels [TC:1]    397536 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  397536 NCBI-ProteinID:  NP_999450 Ensembl:  ENSSSCG00000007229 UniProt:  O77737 LinkDB All DBs Position 17 AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttactgatgtggaagagaacagaactgaggccccagaaggg actgaatcagaagcggaaacccctagtgccatcaatggcaacccatcctggcacctggcg gacagccccgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggctgcagtgaagcaagcgctgagggaggcgggcgatgagtttgaactgagg taccggagggcattcagtgacctgacgtcccagctccacatcaccccagggacagcgtat cagagctttgagcaggtattgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacggaaacaatgcagca gctgagagccggaagggccaggaacgcttcaaccgatggttcctgacgggcatgactcta gctggggtggttctgctgggttcgctcttcagtcggaaatga

DBGET integrated database retrieval system