KEGG   Sus scrofa (pig): 397543
Entry
397543            CDS       T01009                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X2
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc04141  Protein processing in endoplasmic reticulum
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05160  Hepatitis C
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    397543 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    397543 (BAK1)
   04215 Apoptosis - multiple species
    397543 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397543 (BAK1)
   05202 Transcriptional misregulation in cancer
    397543 (BAK1)
   05206 MicroRNAs in cancer
    397543 (BAK1)
   05203 Viral carcinogenesis
    397543 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397543 (BAK1)
   05212 Pancreatic cancer
    397543 (BAK1)
   05225 Hepatocellular carcinoma
    397543 (BAK1)
   05226 Gastric cancer
    397543 (BAK1)
   05214 Glioma
    397543 (BAK1)
   05216 Thyroid cancer
    397543 (BAK1)
   05220 Chronic myeloid leukemia
    397543 (BAK1)
   05217 Basal cell carcinoma
    397543 (BAK1)
   05218 Melanoma
    397543 (BAK1)
   05213 Endometrial cancer
    397543 (BAK1)
   05224 Breast cancer
    397543 (BAK1)
   05222 Small cell lung cancer
    397543 (BAK1)
   05223 Non-small cell lung cancer
    397543 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    397543 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    397543 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    397543 (BAK1)
   05160 Hepatitis C
    397543 (BAK1)
   05164 Influenza A
    397543 (BAK1)
   05162 Measles
    397543 (BAK1)
   05168 Herpes simplex virus 1 infection
    397543 (BAK1)
   05163 Human cytomegalovirus infection
    397543 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    397543 (BAK1)
   05169 Epstein-Barr virus infection
    397543 (BAK1)
   05165 Human papillomavirus infection
    397543 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    397543 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssc03029]
    397543 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    397543 (BAK1)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    397543 (BAK1)
Transporters [BR:ssc02000]
 Other transporters
  Pores ion channels [TC:1]
   397543 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 397543
NCBI-ProteinID: XP_001928182
Ensembl: ENSSSCG00000001516
UniProt: F1RZR2 A0A4X1T650
LinkDB
Position
7
AA seq 211 aa
MASGQGPGPPRQGCGEPDPSSTSEEQVARDTEEVFRSYVFHRHQQEQEAEGAAAPTDPEM
VTLPLEPSSTMGQVGRQLAIIGDDINRRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALYVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LDLGNGPIRNVLLVLAVVLLGQFVVRRFFRS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcgtccggccaaggcccaggcccccccaggcagggctgtggagagcccgacccctcg
tccacatcagaggagcaggtggcccgggacacggaggaggttttccgcagctacgttttt
caccgccatcagcaggagcaggaggccgagggggcagctgcgcccaccgacccagagatg
gtcaccctgcccctagaacctagcagcaccatggggcaggtaggccgccagctcgccatc
attggggatgacatcaaccggcgatacgactcggaattccaggccatgctgcagcacctg
cagccgacagcggaaaacgcctatgagtacttcaccaagatcgcctccagcctgttcgag
agtggcatcaactggggccgagtggtggctcttctgggctttggctaccgcctggccctg
tacgtctaccagaggggcctgaccggcttcctaggccaggtgacccgctttgtggccgac
ttcatgctgcatcactgcatcgcccggtggattgcgcagaggggtggctgggtggcagcc
ctggatttgggaaacggccccatccggaacgtgctgctagttctggctgtggttttgctg
ggccagtttgtggtacgcagattcttcaggtcatga

DBGET integrated database retrieval system