KEGG   Sus scrofa (pig): 397564
Entry
397564            CDS       T01009                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor precursor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04912  GnRH signaling pathway
ssc04915  Estrogen signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc05171  Coronavirus disease - COVID-19
ssc05205  Proteoglycans in cancer
ssc05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    397564 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    397564 (HBEGF)
   04915 Estrogen signaling pathway
    397564 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    397564 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    397564 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    397564 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    397564 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    397564 (HBEGF)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   397564 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 397564
NCBI-ProteinID: NP_999464
Ensembl: ENSSSCG00000014362
UniProt: Q01580
LinkDB
Position
2
AA seq 208 aa
MKLLPSVVLKLFLAAVFSALVTGESLERLRRGLADGTSNLVSPTESTDQLLPPGGGRGRE
VLDLEEADLDLLRADFSSKPQALATPSKEERGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVKNRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGVTASH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttctggctgcagtgttctcggcgctg
gtgaccggcgagagcctggagcgcctgcggagggggctggcggatggaaccagcaatctg
gtctcccctaccgaatctacggaccagctgctgcccccgggaggtggccgaggccgggaa
gtcctggacttggaagaggcagacctggaccttttgagagctgatttctcttccaagcca
caagctctggccacaccgagcaaggaggagcgagggaaaagaaagaagaaaggcaaaggg
ttagggaagaagagagacccgtgccttcggaagtacaaggatttctgcatccacggagag
tgcaagtacgtgaaggagctccgggcgccatcctgcatctgccaccccggttaccacgga
gagaggtgtcatgggctgagcctcccggtgaaaaatcgtttatatacatatgatcacacc
accatcctggctgtggtggccgtggtgctgtcgtccgtctgtctgctcgtcattgtgggg
cttctcatgttcaggtaccacaggagaggaggttatgacgtggaaaatgaagagaaagtg
aaattgggcgtgactgcttcccactga

DBGET integrated database retrieval system