KEGG   Sus scrofa (pig): 397567Help
Entry
397567            CDS       T01009                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00480  Glutathione metabolism
ssc00980  Metabolism of xenobiotics by cytochrome P450
ssc00982  Drug metabolism - cytochrome P450
ssc00983  Drug metabolism - other enzymes
ssc01524  Platinum drug resistance
ssc05200  Pathways in cancer
ssc05204  Chemical carcinogenesis
ssc05225  Hepatocellular carcinoma
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    397567 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    397567 (MGST1)
   00982 Drug metabolism - cytochrome P450
    397567 (MGST1)
   00983 Drug metabolism - other enzymes
    397567 (MGST1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    397567 (MGST1)
   05204 Chemical carcinogenesis
    397567 (MGST1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    397567 (MGST1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    397567 (MGST1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    397567 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    397567 (MGST1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     397567 (MGST1)
Transporters [BR:ssc02000]
 Other Transporters
  Pores ion channels [TC:1]
   397567 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 397567
NCBI-ProteinID: NP_999465
UniProt: P79382
LinkDB All DBs
AA seq 155 aa AA seqDB search
MADLTELMKNEVFMAFASYATIVLSKMMFMSTATAFYRLTRKVFANPEDCSSFGKGENAK
KYLRTDERVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTIA
YLTPLPQPNRGLAFFLGYGVTLSMAYRLLKSRLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggctgacctcacggagctaatgaaaaatgaagtattcatggcctttgcctcctatgca
acaatcgttctttcaaaaatgatgtttatgagtactgcaactgcattctataggttgaca
agaaaggtttttgccaacccagaagactgctcaagctttggcaagggagaaaatgccaag
aagtatcttcggacagatgaaagagtggaacgtgtacgaagagcccacctgaatgacctt
gaaaatattgtgccattccttggcattggccttctgtattccttgagtggtccagatctc
tctacggccatcctgcacttcagactctttgttggcgcgcgaatctaccacacgattgcg
tatttgacaccccttccccagccaaatcgtggtttggcttttttccttggatatggagtt
acactttcaatggcttacaggttactgaagagtaggttgtacctgtaa

DBGET integrated database retrieval system