KEGG   Sus scrofa (pig): 397584
Entry
397584            CDS       T01009                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04151  PI3K-Akt signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04934  Cushing syndrome
ssc05162  Measles
ssc05165  Human papillomavirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05206  MicroRNAs in cancer
ssc05215  Prostate cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    397584 (CDKN1B)
   04066 HIF-1 signaling pathway
    397584 (CDKN1B)
   04068 FoxO signaling pathway
    397584 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    397584 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397584 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397584 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    397584 (CDKN1B)
   05206 MicroRNAs in cancer
    397584 (CDKN1B)
   05203 Viral carcinogenesis
    397584 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    397584 (CDKN1B)
   05220 Chronic myeloid leukemia
    397584 (CDKN1B)
   05215 Prostate cancer
    397584 (CDKN1B)
   05222 Small cell lung cancer
    397584 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397584 (CDKN1B)
   04934 Cushing syndrome
    397584 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    397584 (CDKN1B)
   05169 Epstein-Barr virus infection
    397584 (CDKN1B)
   05165 Human papillomavirus infection
    397584 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    397584 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 397584
NCBI-ProteinID: NP_999481
Ensembl: ENSSSCG00000027140
UniProt: Q9BDC3 A0A4X1V4V1
LinkDB
Position
5
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQEGQGVSGTRQAVPLIG
SQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPN
SASVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgagagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctcggcctgccgaaacctcttcggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcaaatacgagtggcaggaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagggccagggtgtcagcgggacccgccaggcggtgcctttaattggg
tctcaggccaactcagaggacacacatttggtagaccaaaagactgatgcaccggacagc
cagacggggttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccgaac
tcggcttcagtggagcagacgcccaagaagcccggcctcagaaggcgtcaaacgtaa

DBGET integrated database retrieval system