KEGG   Sus scrofa (pig): 397590Help
Entry
397590            CDS       T01009                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00590  Arachidonic acid metabolism
ssc01100  Metabolic pathways
ssc04064  NF-kappa B signaling pathway
ssc04370  VEGF signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04668  TNF signaling pathway
ssc04723  Retrograde endocannabinoid signaling
ssc04726  Serotonergic synapse
ssc04913  Ovarian steroidogenesis
ssc04921  Oxytocin signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc05140  Leishmaniasis
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05204  Chemical carcinogenesis
ssc05206  MicroRNAs in cancer
ssc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    397590 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    397590 (PTGS2)
   04064 NF-kappa B signaling pathway
    397590 (PTGS2)
   04668 TNF signaling pathway
    397590 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    397590 (PTGS2)
   04657 IL-17 signaling pathway
    397590 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    397590 (PTGS2)
   04913 Ovarian steroidogenesis
    397590 (PTGS2)
   04921 Oxytocin signaling pathway
    397590 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    397590 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    397590 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    397590 (PTGS2)
   05206 MicroRNAs in cancer
    397590 (PTGS2)
   05204 Chemical carcinogenesis
    397590 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    397590 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    397590 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    397590 (PTGS2)
   05165 Human papillomavirus infection
    397590 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    397590 (PTGS2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     397590 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 397590
NCBI-ProteinID: NP_999486
UniProt: Q8SPR3
LinkDB All DBs
Position
9
AA seq 604 aa AA seqDB search
MLARALLLCAAVSLCTAAKPCCSNPCQNRGICMSVGFDHYKCDCTRTGFYGENCTTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLISRSHLIDSPPTYNMHY
GYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVEKLLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDQKRGPAFTKGQGHGVDLSHVYGESLERQHKLRLFKDGKMKY
QIIDGEMYPPTAKDTQVEMIYPPHTPEHLRFAVGHEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDAFQIDGHEYNYQQFLYNNSILLEHGITQFVESFSRQIAGRV
AGGRNLPAAVQKVSKASIDQSREMRYQSFNEYRKRFLLKPYRSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFSVQDPQLAKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctctgcgctgccgtgtcgctctgcactgcagcaaagcct
tgctgttccaacccatgccagaatcggggtatatgtatgagtgtaggatttgaccactat
aagtgtgactgcacccgaacaggattctacggtgaaaactgtactacacctgaatttctg
acaaggataaaattattcctgaagcccactccaaacacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataatattcccttcctgcggaatgcaattatgaaa
tacgtattgatatcgagatcacatctgattgatagcccaccaacttacaatatgcactat
ggctataaaagctgggaagccttttctaacctctcctattataccagagctcttcctcct
gtgcctgatgactgcccaacacccatgggtgtgaaagggaggaaagagcttcccgattca
aaggaagttgtggaaaaattacttctaagaagaaagttcatccctgatccccagggcaca
aacatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcag
aagcgaggaccagctttcaccaaaggacagggccatggggtggacttaagtcatgtttat
ggtgaatctttggagagacagcataaactgcgccttttcaaggatggaaaaatgaagtat
cagataattgatggtgagatgtatcctccgacagccaaagacactcaagtcgagatgatc
tacccgcctcacactcctgaacacctccgctttgccgtggggcatgaggtctttggtctg
gtgcctggtctgatgatgtacgccacaatctggctgcgggaacataatagagtgtgcgat
gtgcttaaacaggagcacccggaatgggacgatgaacggctgttccagacgagcaggctg
atactgataggagaaacgattaagattgtgatcgaagactatgtacaacacctgagtggc
taccacttcaaactgaagtttgacccagagctgcttttcaaccagcaattccaataccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacgcc
ttccagattgatggccacgagtacaactatcaacagtttctctacaataactctatctta
ctggaacatggcatcacccaatttgttgaatcatttagcaggcaaattgctggcagggtt
gctggtggtaggaatcttccagctgcagtacaaaaagtatcaaaggcctcaatcgaccag
agcagagagatgagataccagtcttttaatgaataccgcaagcgctttctgctgaagccc
tatcgatcatttgaagaacttacaggagagaaggaaatggctgcagagttagaagcgctc
tatggtgacattgatgccatggagctgtatcctgcccttctggtagaaaagcctcgccca
gatgccatctttggggagaccatggtagaagctggagccccattctccttgaaaggactt
atgggtaatcctatctgttctcctgagtactggaagcctagtacttttggtggagaagta
ggttttaaaatcatcaacactgcctcgattcagtctctcatctgcaataatgtgaaaggc
tgcccttttacctcattcagtgttcaagatccacagctcgccaaaacagtcacaattaat
gcaagctcttcccactctggactagatgatatcaaccccacagtactactaaaagaacga
tcgacggaactgtag

DBGET integrated database retrieval system