KEGG   Sus scrofa (pig): 397620
Entry
397620            CDS       T01009                                 

Gene name
FN1
Definition
(RefSeq) LOW QUALITY PROTEIN: fibronectin
  KO
K05717  fibronectin 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04512  ECM-receptor interaction
ssc04810  Regulation of actin cytoskeleton
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05100  Bacterial invasion of epithelial cells
ssc05135  Yersinia infection
ssc05146  Amoebiasis
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    397620 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    397620 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    397620 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    397620 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397620 (FN1)
   05205 Proteoglycans in cancer
    397620 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    397620 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397620 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    397620 (FN1)
   05100 Bacterial invasion of epithelial cells
    397620 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    397620 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397620 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    397620 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    397620 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397620 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:ssc04990]
    397620 (FN1)
Membrane trafficking [BR:ssc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    397620 (FN1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   397620 (FN1)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   397620 (FN1)
Domain-containing proteins not elsewhere classified [BR:ssc04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   397620 (FN1)
SSDB
Motif
Pfam: fn3 fn1 fn2 Pur_ac_phosph_N DUF2369 Interfer-bind
Other DBs
NCBI-GeneID: 397620
NCBI-ProteinID: XP_003133690
Ensembl: ENSSSCG00000016174
LinkDB
Position
15
AA seq 2625 aa
MHVLQRGHCHQNCSPETRLQKKHRPVFVLLPCSRQRSLPYSPRDQPQDAEQGSEEQSMQI
SENKKKSMYFKKALASGLSCLYPDFQFDDRKGNQKKVLLPQSWRAISISFVRCEPTVLLT
SPGAQANRRAVGGGGKRRSVYIPAPSQDARGPGPGLLLLAVLSLGTTVPSTGASKSKRQA
QQIVQPQSPLVDSQRKPGCYDNGKHYQINQQWERTYLGSALVCTCYGGSRGFNCESKPEP
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDT
WRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGGTSYVVGETWEKPYQGWMMVD
CTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCER
HTSLQTTSAGSGSFTDVRTAIYQPQPHPQPAPYGHCVTDSGVVYSVGMQWLKTQGNKQML
CTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNY
EQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNY
DADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYS
QLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQI
GDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPGTTGPVQVIITETPSQPNSHPIQWNA
PEPSHISKYILRWKPKNSPNRWKEATIPGHLNSYTIKGLRPGVVYEGQLISVQHYGHREV
TRFDFTTTSTSSAVTSNTVVGETTPFSPVVATSESVTEITASSFVVSWVSASDTVSGFRV
EYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGEQSLILSTSQTTAPD
APPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQP
GVQYNITIYAVEENQESTPVFIQQETTGVPRPDKVPPPKDLQFVEVTDVKVTIMWTPPES
PVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYHFKVFAVNQGRESKPLTAQ
QTTKLDAPTNLQFINETDSTVMVTWTPPRARIAGYRLTVGLTRGGQPKQYNVGPSASQYL
LRNLQPGSEYAVTLVAVKGNQQSPRATGVFTTLQPVGSIPPYNTEVTETTIVITWTPAPR
IGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTISVLRDGQERDTPIVKKVVT
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGYSLEEVVHADQSSC
TFENLSPGLEYNVSVYTVKNDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPINS
STIIGYRITVVAAGEGIPIFEDFADSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTL
TQQTAVPPPTDLRFTNVGPDTIRVTWAPPPSIELTNFLVRYSPVKNEEDVAELSISPSDN
AVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTGLDSPTGIDFSDITANSFTVYWIAP
RATITGYKIRHHPEHMGGRPREDRVPPSRNSITXTNLIPGVEYVVSIVAVNGREESPPLV
GQQSTVSDVPRDLQVIATTPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS
TATISGLKPGVDYTITVYAVTGRGDSPASSKPVSIDYRTEIDKPSQMQVTDVQDNSISVR
WLPSSSHVTGYRVTTTPKNGSGPSKTKTVGPDQTEMTIEGLQPTVEYVVSVYAQNQNGES
QPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPD
GEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTNLKFTQVTPTSLTAQ
WTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSIYALKDTLTS
RPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTI
KPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLV
SWQPPRAKITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPATEYTIQVIALKNNQK
SEPLIGRKRTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTKPGYDTGNGIQLPGTSG
QQPSLGQQMIFEEHGFRRTTPPTTATPVRHRPGPYTPNVNEEIQVGHVPRGDVDHHLYPH
VLGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPVGIDEEPLQFRVPGTSASATLTG
LTRGATYNIIVEALKDQKRHKIREEVVTVGNSVDQGLSQPTDDSCFDPYTVSHYAIGEEW
ERLSESGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGN
GKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAELG
PEGSTGHSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADIEDSRE
NT seq 7878 nt   +upstreamnt  +downstreamnt
atgcatgttctgcagagaggacactgccaccagaactgtagccctgaaaccagactgcag
aagaaacaccgtcctgtctttgtcctcctgccctgcagcaggcagaggagtctgccgtac
agtccaagggatcagccccaagatgcagagcaaggcagtgaagaacagagcatgcagatc
tcggagaacaaaaaaaaatccatgtattttaagaaagcattggcttcaggtttatcttgc
ttatatcctgatttccagtttgacgaccgcaaaggaaaccaaaaaaaagttctcttgccc
cagtcctggcgggcgatcagcatctcttttgttcgctgcgaacccacagtcctcctgacg
tcacccggagcccaggccaatcggcgagcggtcggcggcggcggcaagaggaggagcgtc
tatatccccgcaccttctcaagatgctcggggtccaggacccgggcttctgctgctggcc
gtcctgtccctggggacaacggtgccctccactggagcgtcgaagagcaagaggcaggct
cagcagatcgttcagccccaatccccgttggttgacagccaacgcaagcctggttgttac
gacaatggaaaacactatcagataaaccaacaatgggagcgcacttacctgggcagtgcc
ttggtttgtacctgttatggagggagccggggcttcaactgtgagagcaagcctgagcct
gaagagacctgctttgacaagtacactgggaacacttaccgggtgggcgacacttatgag
cgccctaaagactccatgatctgggactgtacctgcattggagctgggcgaggcagaata
agttgcaccattgcaaaccgctgccatgaagggggtcagtcctacaagattggtgacact
tggaggagaccgcatgagactggtggttacatgttagagtgtgtgtgtcttggtaatggg
aaaggagaatggacctgcaagcccatagctgagaaatgttttgatcacgcggctggaggg
acttcctacgttgtcggggagacctgggaaaagccttatcagggctggatgatggtggat
tgtacttgtctgggagaaggcagtggacgtatcacctgcacctctagaaacagatgcaac
gatcaggacaccagaacatcctatagaattggggatacctggagcaagaaggacaatcgg
gggaacctgctccagtgcatctgcacaggcaacggccgtggggagtggaagtgtgagagg
cacacatctctgcagaccacatctgctggatctggctccttcacagatgtccgaacagcc
atttaccagccccagcctcacccccagcctgctccatatggtcactgtgtcacagacagc
ggtgtggtttattccgtggggatgcagtggctgaagacacaaggaaataagcaaatgctt
tgcacttgcctgggcaatggagtcagctgccaagagacagctgtcacccagacttacggt
ggcaactccaacggggagccatgcgtcctcccgttcacctacaatggcaggaccttctac
tcctgcaccacagaagggcgacaggacggacatctctggtgcagcacgacttccaattat
gaacaagaccagaaatattctttctgtacagaccatactgttctggttcagactcgaggt
ggaaattccaatggtgctttgtgccactttcccttcctgtacaacaaccgaaactacacc
gactgtacttccgagggcagaagggacaacatgaaatggtgtggaaccacacagaactat
gacgctgaccagaagtttggattctgccccatggctgcccatgaggaaatctgtacaacc
aacgaaggagtcatgtatcgcatcggagatcagtgggacaaacagcatgatatgggtcac
atgatgagatgcacatgtgttgggaacggtcgcggggaatggacatgtgttgcttactca
cagctccgagatcagtgcattgttgacgatatcacatacaatgtgaatgacacgttccac
aaacgtcacgaggagggacacatgctgaactgcacctgctttggtcagggtcggggccga
tggaagtgcgatcccgttgaccaatgccaggattcggaaacccgcaccttttatcaaatt
ggagactcatgggagaagtatgtgcatggggtcaggtaccagtgctactgctatggccga
ggcattggagagtggcactgccaacccttacagacctatccaggcacaactggtcctgtc
caagtgatcatcactgagacccccagtcagcccaactcgcaccccatccaatggaatgca
ccagaaccatctcacatttccaagtacattctcagatggaaacctaaaaattctccaaac
cgttggaaggaagccaccattccaggccacttgaactcatacaccatcaagggcttgcgg
ccaggtgtggtatacgagggccagctcatcagcgtccagcactacggccacagagaggtg
actcgcttcgacttcaccaccaccagcacaagctcagcagtgaccagcaacaccgtggtg
ggagagacaacacccttttctcctgttgtggccacttccgaatcagtgacggaaatcaca
gccagcagctttgtggtctcctgggtctcggcatcggacactgtgtcaggattccgggtg
gagtatgagctgagcgaggagggcgatgaaccacagtacctggatcttcccagcacagcc
acttctgtgaacatccctgacctgcttcctggccgaaaatacattgtgaatgtctatcag
atatccgaagaaggagagcagagtttgattctgtccacttcgcagacaacagcccctgat
gctcctcctgaccctactgtggaccaagttgatgacacctcgattgtcgttcgctggagc
agaccccaggcacctatcacaggctatagaatcgtctattccccgtctgtagaaggtagt
agcacagaactcaaccttcctgaaactgccaactctgtcactctcagtgacttgcaacct
ggtgttcagtataacatcacaatctatgctgtggaagaaaatcaagaaagtacccctgtc
ttcatccagcaagaaaccactggcgtcccacgtccagataaagtgccccctcccaaggac
ctgcagtttgtggaagtgacggacgtgaaggtcaccatcatgtggacaccccccgagagc
ccggtgaccggttaccgcgtggacgtgatccccgtcaacctgcctggcgagcatgggcag
aggctgcccatcagcaggaacacctttgcagaagtcaccgggctgtcccctggagtcacc
taccacttcaaagtcttcgccgtgaaccaggggagggagagcaagcctctgacagcacaa
cagacaaccaaattggatgctcccaccaacctccagtttatcaacgaaacggactcaacc
gtcatggtgacctggacgccacctcgcgccaggatagccgggtaccgattgactgtgggc
ctgacccggggaggccagcccaagcagtacaacgtggggccctcagcctcgcagtaccta
ctaaggaatctgcagcctggctctgagtatgctgtgaccctcgtggccgtaaaaggcaac
cagcagagccccagagccactggcgtcttcaccactctgcagcctgtgggctccattcca
ccttacaacacagaggtgactgagaccaccattgtgatcacatggacccctgccccaagg
atcggctttaagctgggtgtacgaccaagccagggaggggaagcaccacgagaagtgact
tcagactcgggaagcatcgttgtgtccggcctgactccaggcgtggaatacgtttacacc
atctcagtcctgagagacgggcaagaaagagataccccaattgtgaagaaagtggtgaca
ccactgtctccaccaacaaacttgcacctggaggcaaaccctgacactggagtgcttacc
gtctcctgggagaggagcaccaccccagacattactggctatagaattaccaccacccct
acaaatggccagcagggatattctttggaagaagtggtccatgcagatcagagttcctgc
acctttgaaaacctaagccctggcctggagtacaatgtcagtgtttatactgtcaaaaat
gacaaggaaagtgttcctatctctgataccatcatcccagaggtgccccaactcactgac
ctaagctttgttgatataaccgattcaagcatcggcctgaggtggaccccgattaactct
tccaccattatcgggtaccgcatcacagtagttgcggcaggagaaggtatccctattttt
gaagattttgcggactcctcagtaggatactacacagttacagggctggagcctggcatt
gactatgacatcagcgttatcactctcattaatggcggagagagtgcccctactacactg
acacagcaaacggctgtccctcctcccactgacctgcgatttaccaatgttggtcctgat
acgatacgtgtcacctgggctccacctccatccattgaactgaccaacttcctggtgcgc
tactcccctgtgaaaaatgaggaggatgtggcagagctgtccatttctccttcagacaac
gcagtggtcctcacaaatctgctgcctggcacagagtatttagtcagcgtctccagtgtc
tatgagcagcatgaaagcatacctctcagaggaagacagaaaacaggtcttgattcccca
actggcattgacttctctgatatcaccgccaactctttcactgtgtactggattgctcct
cgcgccaccatcactggctacaagatccgccatcaccctgagcacatgggtggaagacct
cgggaagatcgcgtgcccccctctcggaattccatcaccntcaccaacctcattccaggc
gtggaatatgtggtcagcatcgtcgctgttaatggcagagaggaaagccctcccttggtc
ggccaacaatcaacagtttctgatgttccaagggacctgcaagtcattgccacaaccccc
actagcctgttgatcagctgggatgctcctgctgtcacagtgagatattacaggatcacg
tatggagaaacaggaggaaatagccctgtccaggagttcactgtgcctgggagcaagtct
acagctaccatcagtggccttaagcctggagtagactacaccatcaccgtctatgctgtc
actggccgtggggacagcccagcaagcagcaagcccgtttccattgattatcgaacagaa
attgataaaccatcccagatgcaagtgactgatgtccaggacaacagcatcagtgtcagg
tggctgccttcaagttcccatgttactggttacagagtgaccactactcctaaaaatggc
tcaggaccatcaaaaacgaaaactgttggtccagatcaaacagaaatgacaatagaaggc
ttgcagcccacagtggagtatgtggttagtgtctacgctcagaatcaaaacggagagagt
cagcctctggttcagacagcggtaaccaacattgatcgccccaaaggactggcattcact
gatgtggatgtcgattccatcaaaattgcttgggaaagcccacaggggcaagtttccagg
tacagggtgacctactcgagccctgaggatggaatccatgagctattccctgcacctgat
ggtgaagaagacactgcagagctgcaaggcctcaggccgggttctgagtacacagtcagt
gtggttgccttgcacgatgatatggagagccagcccctgattggaacccagtccacagcc
attcctgcaccaaccaacctgaagttcactcaggtaacacccacaagcctgactgcccag
tggacagcccccaacgttcagctcactgggtatcgagtgcgggtgacccccaaggagaag
accgggccaatgaaggaaatcaaccttgctcctgatagctcctctgtggtcgtatcagga
ctcatggtggccaccaagtatgaagtgagcatctatgctcttaaggacactttgacaagc
agaccagctcagggagttgtcacgaccctggagaatgtcagtcctccaagaagggcccgg
gtgacagatgctactgagaccaccatcaccattagctggaggaccaagactgagacgatc
accggcttccaagttgatgccgtcccagccaatggccagactccaatccagagaaccatc
aagccagatgtcaggagctacaccatcacaggtttacaacccggcactgactacaagatc
tacttgtacaccctgaatgacaatgcccggagctcccctgtggtcatcgatgcctccact
gccatcgatgcaccatccaacttgcgtttcctggccaccacacccaattccttgttggta
tcatggcagccaccccgtgccaagattactggttacatcatcaagtatgagaagcctggg
tcccctcccagagaagtggtccctcggccccgccctggtgtcacagaagctactattact
ggtctggaaccagcaaccgagtacacaatccaggtcattgccctcaagaacaatcagaag
agtgagcctctgatcgggaggaaaaggacagatgagcttccccaactggtaacccttcca
caccccaatcttcatggaccagagatcttggatgttccctccacagttcaaaagacccct
ttcgtcaccaaacccgggtatgacactggaaacggtattcagcttcctggcacttctggt
cagcagcccagtcttgggcaacaaatgatctttgaggagcatggttttaggagaaccaca
ccgcccacaacggccacccccgtaaggcataggccaggaccgtatacgccgaatgtaaat
gaggagatccaagttggtcatgtccccaggggagacgtagaccatcacctctaccctcac
gttctgggactcaatccaaatgcttctacaggacaagaagctctctctcagacaaccatc
tcatggaccccattccaggaaagctctgaatatatcatttcatgtcatcccgtgggcatt
gatgaagaacccttgcagttccgagttcctggaacttctgctagtgccaccttgacgggt
ctcaccagaggtgccacctacaacatcatagtggaggcactaaaagaccagaagaggcac
aagattcgggaggaggtggttactgtgggcaattctgttgaccaaggcctaagccaaccc
acggatgactcgtgcttcgacccctacacggtttcccattatgccatcggagaagagtgg
gagcgattatctgaatctggctttaagctctcgtgccagtgcttaggctttggcagtggt
catttcagatgtgattcatctaaatggtgccatgacaatggtgtgaattacaagattgga
gagaagtgggatcgtcagggagagaatggccagatgatgagctgcacatgtctcggaaat
ggaaaaggagaattcaagtgtgatccccatgaagcgacgtgttatgatgatgggaagaca
taccatgtgggagaacagtggcagaaggaatatctcggtgccatttgctcctgcacgtgc
tttggaggccagcggggctggcgctgtgacaactgccgcagaccaggggctgaactcggt
cccgaaggctccaccgggcactcctacaaccagtattcacagagataccatcagagaaca
aacaccaatgtcaactgcccaattgagtgcttcatgcctttagatgtacaggctgacata
gaagattcccgagagtaa

DBGET integrated database retrieval system