KEGG   Sus scrofa (pig): 397646
Entry
397646            CDS       T01009                                 

Gene name
NLN
Definition
(RefSeq) neurolysin, mitochondrial
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    397646 (NLN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    397646 (NLN)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     397646 (NLN)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M3
   397646 (NLN)
SSDB
Motif
Pfam: Peptidase_M3 DUF5537
Other DBs
NCBI-GeneID: 397646
NCBI-ProteinID: NP_999524
Ensembl: ENSSSCG00000016778 ENSSSCG00000016951
UniProt: Q02038
LinkDB
Position
16
AA seq 704 aa
MIVRCLSAARRLHRVGGSGILLRMTLGREAMSPLQAMSSYTVDGRNVLRWDLSPEQIKRR
TEELIAQTKQVYDDIGMLDIEEVTYENCLQALADVEVKYIVERTMLDFPQHVSSDKEVRA
ASTEADKRLSRFDIEMSMREDIFLRIVRLKETCDLGKIKPEARRYLEKSVKMGKRNGLHL
PEQVQNEIKAMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDNKYK
ITLKYPHYFPVMKKCCIPETRRKMEMAFNTRCKEENTIILQELLPLRAKVAKLLGYSTHA
DFVLEMNTAKSTHHVTAFLDDLSQKLKPLGEAEREFILNLKKKECEEKGFEYDGKINAWD
LHYYMTQTEELKYSVDQEILKEYFPIEVVTEGLLNIYQELLGLSFEQVTDAHVWNKSVTL
YTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMSVAALVVNFSQPR
AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDTD
SLRRLSKHYKDGSPITDDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY
AKYCTEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPE
VGMKYRNLILKPGGSLDGMDMLQNFLKREPNQKAFLMSRGLHAP
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgatcgtccggtgcctttcggctgcgagacgcctccacagggttggtggttccgggatt
ttattgagaatgactttagggagagaagcaatgtctcctcttcaggcaatgtcttcctat
actgtggatggcagaaatgttttaagatgggatctttcaccagagcaaattaaaagaaga
actgaggagctgattgcgcagaccaaacaggtgtatgatgatattggaatgcttgacatt
gaagaggtaacttatgagaactgtttgcaggcactggcagatgtggaagtgaagtatata
gtggaacgaaccatgctagactttccccagcatgtctcctctgacaaagaagtacgagca
gcaagtacagaagcagacaaaagactttctcgttttgatattgagatgagcatgagagaa
gatatctttctgagaattgttcgtttaaaggagacctgtgatttggggaagatcaagcct
gaagccagaagatacttagaaaaatcagttaaaatgggaaaaaggaatgggctccatctt
ccggaacaagtacagaatgaaatcaaagcaatgaagaaaagaatgagtgagctatgtatt
gacttcaacaaaaacctcaatgaggacgataccttccttgtattttccaaggctgaactt
ggtgctcttcctgatgatttcattgacagtttagaaaagacagatgacaacaagtataaa
attaccttaaaatatccacactattttcctgtcatgaagaaatgttgtatccctgaaacc
agaaggaaaatggaaatggcttttaatacgaggtgcaaagaggaaaacaccataatcctg
caggagctactcccactgcgggccaaagtagccaaactactgggctacagcacacatgct
gactttgtccttgagatgaacactgcgaagagtacacaccatgtgacagcctttctagat
gatttaagccagaaattaaaacccttgggtgaggcagaacgagagttcattttgaatttg
aagaaaaaggaatgtgaagagaaaggttttgaatatgatggcaaaatcaatgcctgggat
ctacattactatatgactcagacagaagaactcaagtactctgtggaccaagagatcctc
aaggaatacttcccaattgaagtggtcactgaaggcttgctgaacatctatcaggagttg
ttgggactctcctttgagcaagtgacagatgctcatgtttggaataaaagtgttaccctg
tacacggtgaaggataaagccacaggagaagtattaggacagttctacttggacctctat
ccaagggaaggaaaatacaaccatgcagcctgctttggtctccagcctggctgcctcctg
cctgatgggagccgcatgatgtctgtggctgccctcgtggtgaacttctcacagccacga
gcaggtcgtccctctctcctgagacacgatgaggtgaggacttacttccatgaatttggt
cacgtcatgcatcagatttgtgcgcagactgactttgcacgatttagtggaacaaatgtg
gaaactgactttgtagaggtgccatcacaaatgcttgaaaactgggtgtgggacactgat
tccctccgaaggctgtcaaaacattataaagatggaagccctattacagatgatctgctt
gaaaaacttgttgcttctagactggtcaacacaggtctcctgaccttacgccagattgtt
ttgagcaaagttgatcagtctctccacaccaacacttcgctggatgctgcaagtgaatat
gccaaatactgcacagaaattttaggtgttgcagctactccaggcacaaatatgccagct
acttttggacacttggcagggggatatgatggccaatattatggatatctttggagtgaa
gtcttttccatggacatgttttatagctgttttaaaaaagaagggataatgaatccagag
gttggaatgaaatacagaaacctaatcctgaaacctgggggatcgctggacggcatggac
atgctccaaaatttcttgaaacgtgagccaaaccaaaaagcgttcctaatgagtagaggc
ctgcatgctccgtaa

DBGET integrated database retrieval system