KEGG   Sus scrofa (pig): 397657Help
Entry
397657            CDS       T01009                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04015  Rap1 signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04510  Focal adhesion
ssc04520  Adherens junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04670  Leukocyte transendothelial migration
ssc04916  Melanogenesis
ssc04919  Thyroid hormone signaling pathway
ssc04934  Cushing syndrome
ssc05100  Bacterial invasion of epithelial cells
ssc05160  Hepatitis C
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    397657 (CTNNB1)
   04310 Wnt signaling pathway
    397657 (CTNNB1)
   04390 Hippo signaling pathway
    397657 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    397657 (CTNNB1)
   04520 Adherens junction
    397657 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    397657 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    397657 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    397657 (CTNNB1)
   04916 Melanogenesis
    397657 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397657 (CTNNB1)
   05205 Proteoglycans in cancer
    397657 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397657 (CTNNB1)
   05225 Hepatocellular carcinoma
    397657 (CTNNB1)
   05226 Gastric cancer
    397657 (CTNNB1)
   05216 Thyroid cancer
    397657 (CTNNB1)
   05217 Basal cell carcinoma
    397657 (CTNNB1)
   05215 Prostate cancer
    397657 (CTNNB1)
   05213 Endometrial cancer
    397657 (CTNNB1)
   05224 Breast cancer
    397657 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    397657 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    397657 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    397657 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    397657 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    397657 (CTNNB1)
   05163 Human cytomegalovirus infection
    397657 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    397657 (CTNNB1)
   05165 Human papillomavirus infection
    397657 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 397657
NCBI-ProteinID: NP_999532
Ensembl: ENSSSCG00000011274
UniProt: Q8WNW4
LinkDB All DBs
Position
13
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggctatggagccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccacg
accacagctccttctctaagtggtaaaggcaatcctgaagaagaggatgtggataccacc
caagtcctatatgagtgggagcagggattttctcagtccttcactcaagaacaagtggct
gatattgatggacagtatgcaatgactcgcgctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatctacacagtttgacgctgctcatcccact
aatgtccagcgtctggctgaaccatcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccccgaattgacaaaattgcta
aatgatgaagaccaggtagtggtgaataaggctgcagttatggtccatcagctttccaaa
aaggaagcttccagacatgccatcatgcgttctcctcagatggtgtctgcaattgtacgt
accatgcagaatacaaatgatgtagaaacggctcgctgtactgctgggaccttgcacaat
ctttcccatcatcgtgagggcttgctggccatctttaaatctgggggcattcctgcccta
gtgaagatgcttggttcaccagtggattctgtattgttttatgccattacaactcttcac
aaccttttattgcatcaggaaggagctaaaatggcagtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgc
cttcagattttagcttacggcaatcaagaaagcaagctgatcattctggctagtggtgga
cctcaagctttagtgaatataatgaggacctacacttatgagaaactactgtggaccaca
agccgagtactgaaggtgctctctgtctgctctagtaataagccagctattgtagaagct
ggtggaatgcaagctttaggacttcatctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactcttaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggacccttgttcagcttctgggctcggatgatataaatgtggttacctgtgca
gctggaattctttctaatctcacttgcaataattataaaaacaagatgatggtgtgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgtgctggtgacagggaggacatc
actgaacctgccatctgtgctctccgtcatctgaccagccgacaccaggaagctgagatg
gcccagaatgctgttcgccttcactacggactaccagttgtggttaaactcctacatcca
ccatcccattggcctctcatcaaggctaccgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctttgcgagagcagggtgccattccacgactagttcagttgctg
gttcgtgctcatcaggatacccagcgccgtacgtccatgggtggaacacagcaacagttt
gtggagggggtccgcatggaagaaatagttgaaggttgtactggagcccttcatatccta
gctcgggatgttcacaaccgaattgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccatcgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaagctattgaagctgagggagccacagcacctctg
acagaattactccactctaggaatgaaggtgtggcaacatacgcagctgctgttttgttc
cgaatgtctgaggacaagccccaggattataagaaacggctttcggttgagctgaccagt
tctcttttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatacggccaggatgccttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccccggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system