KEGG   Sus scrofa (pig): 397668
Entry
397668            CDS       T01009                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin precursor
  KO
K09782  amphiregulin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04390  Hippo signaling pathway
ssc05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397668 (AREG)
   04012 ErbB signaling pathway
    397668 (AREG)
   04390 Hippo signaling pathway
    397668 (AREG)
   04151 PI3K-Akt signaling pathway
    397668 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    397668 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    397668 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397668 (AREG)
Chaperones and folding catalysts [BR:ssc03110]
 Intramolecular chaperones
  Others
   397668 (AREG)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   397668 (AREG)
SSDB
Motif
Pfam: FtsL EGF
Other DBs
NCBI-GeneID: 397668
NCBI-ProteinID: NP_999541
Ensembl: ENSSSCG00000008963
UniProt: Q9BDH4 A0A4X1T4E6
LinkDB
Position
8
AA seq 247 aa
MRAPLLPPAPVVLSLLILCSAHYAAGLDVNGTSSGKGEPFSGDHGAEAFEVTSRSEMSSG
SEAPPASEMPSGSDYDYAEEYDNEPHISGYIVDDSVRVEQVVKPKRNRTESENTSDKPKR
KKKGGKSGKNRRNRKKKNPCDAEFQNFCIHGDCKYIEHLEAVTCKCYQDYFGERCGEKSM
KTHTMVHSDLSKIALAAIAAFVSAMSFTAIAVVITIYLRKRYFREYEGAAEERKKLRQEN
ANAHAIA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagagctccgctgctgccgccggcgcccgtggtgctgtcactcttgatcctctgctca
gcccattatgctgctggactggacgtcaacggcacctcctctgggaaaggagaaccattt
tctggggaccatggtgctgaggcatttgaggtgacctccagaagtgagatgtcctcggga
agtgaggctccccctgctagcgaaatgccttctggtagcgactatgactatgctgaagag
tacgataacgaaccgcacatatctggctatattgtagatgattcagtcagagttgaacag
gtagttaagcccaagagaaacagaacagaaagtgaaaatacttcagataaacccaaaaga
aagaaaaagggaggcaaaagtggaaaaaatagaagaaacagaaagaagaaaaatccatgt
gatgcagaattccaaaacttctgcattcacggagattgcaaatatatagagcacctggaa
gcagtaacctgcaaatgttaccaggattactttggtgaacgatgtggggaaaagtccatg
aagactcacaccatggtccacagcgatttatcaaaaattgctttagcagccattgctgct
tttgtctctgccatgagcttcacagctattgctgttgttattacaatctaccttcgaaaa
cgatacttcagggaatatgaaggtgcagctgaagaacgaaagaaacttcgacaagaaaat
gcaaatgcacatgccatagcatga

DBGET integrated database retrieval system