KEGG   Sus scrofa (pig): 406188
Entry
406188            CDS       T01009                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04210  Apoptosis
ssc04380  Osteoclast differentiation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04926  Relaxin signaling pathway
ssc04931  Insulin resistance
ssc05132  Salmonella infection
ssc05134  Legionellosis
ssc05135  Yersinia infection
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05208  Chemical carcinogenesis - reactive oxygen species
ssc05215  Prostate cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    406188 (NFKBIA)
   04668 TNF signaling pathway
    406188 (NFKBIA)
   04024 cAMP signaling pathway
    406188 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    406188 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    406188 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    406188 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    406188 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    406188 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    406188 (NFKBIA)
   04660 T cell receptor signaling pathway
    406188 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    406188 (NFKBIA)
   04659 Th17 cell differentiation
    406188 (NFKBIA)
   04657 IL-17 signaling pathway
    406188 (NFKBIA)
   04662 B cell receptor signaling pathway
    406188 (NFKBIA)
   04062 Chemokine signaling pathway
    406188 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    406188 (NFKBIA)
   04926 Relaxin signaling pathway
    406188 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    406188 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    406188 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    406188 (NFKBIA)
   05208 Chemical carcinogenesis - reactive oxygen species
    406188 (NFKBIA)
   05203 Viral carcinogenesis
    406188 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    406188 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    406188 (NFKBIA)
   05215 Prostate cancer
    406188 (NFKBIA)
   05222 Small cell lung cancer
    406188 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    406188 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    406188 (NFKBIA)
   05161 Hepatitis B
    406188 (NFKBIA)
   05160 Hepatitis C
    406188 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    406188 (NFKBIA)
   05164 Influenza A
    406188 (NFKBIA)
   05162 Measles
    406188 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    406188 (NFKBIA)
   05163 Human cytomegalovirus infection
    406188 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    406188 (NFKBIA)
   05169 Epstein-Barr virus infection
    406188 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    406188 (NFKBIA)
   05135 Yersinia infection
    406188 (NFKBIA)
   05134 Legionellosis
    406188 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    406188 (NFKBIA)
   05140 Leishmaniasis
    406188 (NFKBIA)
   05142 Chagas disease
    406188 (NFKBIA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    406188 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    406188 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    406188 (NFKBIA)
   04131 Membrane trafficking [BR:ssc04131]
    406188 (NFKBIA)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    406188 (NFKBIA)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    406188 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 406188
NCBI-ProteinID: NP_001005150
Ensembl: ENSSSCG00000001952
Vega: OTTSUSG00000001063
UniProt: Q08353
LinkDB
Position
7
AA seq 314 aa
MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcccgcagagcccggccaggagtgggccatggaggggccccgggacgcgctc
aagaaggagcggctactggatgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgcgagatccgcctcgagccgcaggaggcgccc
cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcactgaccatggaagtggtccgccaagtgaagggagat
ctggcttttcttaacttccagaacaacctgcagcagactccactccacttggcggtgatc
accaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcagccccgcgggacccagcacctccactccattctgcaggccaccaac
tacaatggccacacatgtctgcacttagcctcgatccatggctacctgggcattgtggag
ctgttggtgtctttgggtgctgatgtcaacgctcaggagccctgcaatggccgaaccgcc
ctgcatcttgcggtggacctgcagaatcccgacctggtgtcgctcttgttgaagtgtggg
gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacctggggccgc
ccaagcactcggatacagcagcagctgggccagctgaccctagaaaacctccagatgctt
ccagagagcgaggatgaggagagctatgacacggagtcagagttcacagaggatgagctg
ccctatgacgactgcgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system