KEGG   Sus scrofa (pig): 414912
Entry
414912            CDS       T01009                                 

Gene name
SPI1
Definition
(RefSeq) transcription factor PU.1
  KO
K09438  transcription factor PU.1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04380  Osteoclast differentiation
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    414912 (SPI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    414912 (SPI1)
   05202 Transcriptional misregulation in cancer
    414912 (SPI1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    414912 (SPI1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414912 (SPI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    414912 (SPI1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    414912 (SPI1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 414912
NCBI-ProteinID: NP_001001865
Ensembl: ENSSSCG00000013237
Vega: OTTSUSG00000003502
UniProt: Q6PKU1
LinkDB
Position
2
AA seq 270 aa
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFAENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMAPTHASLGHQVSYLPRMCLL
YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLL
RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
VKKVKKKLTYQFSGEVLGRGALVVRRHPPH
NT seq 813 nt   +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctccatcagaagacctg
gttccctatgacacggatctctaccaacgccaaacgcatgaatattacccgtatctcagc
agtgatggagaaagccacagcgaccattactgggacttccacccgcaccacgtgcacagc
gagttcgagagcttcgccgagaaccacttcacggagctgcagagtgtgcagcccccccag
ctgcagcagctctaccgccacatggagctggagcagatgcacgtgctcgacacccccatg
gcacccacccatgccagcctcggccaccaggtttcctacctaccccggatgtgcctcctg
tacccctccctgtccccggcccagcccagctcggatgaggaggagggcgagcggcagagc
cccccactggaagtgtctgacggggaggccgacggcctggagccagggcctggcctcctg
cacggggagacaggcagcaagaagaagatccgcctgtatcagttcctgctggacctgctg
cgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaagggcaccttccag
ttttcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggcaaccgc
aagaagatgacctaccagaagatggctcgcgcgctgcgcaactacggcaagacgggcgag
gtcaagaaggtcaagaagaagctcacctaccagttcagcggggaggtgctgggccgcggg
gccctggtcgtgcggcgccacccaccccactga

DBGET integrated database retrieval system