KEGG   Sus scrofa (pig): 448810
Entry
448810            CDS       T01009                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04110  Cell cycle
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04350  TGF-beta signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04630  JAK-STAT signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc05132  Salmonella infection
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05216  Thyroid cancer
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    448810 (MYC)
   04012 ErbB signaling pathway
    448810 (MYC)
   04310 Wnt signaling pathway
    448810 (MYC)
   04350 TGF-beta signaling pathway
    448810 (MYC)
   04390 Hippo signaling pathway
    448810 (MYC)
   04630 JAK-STAT signaling pathway
    448810 (MYC)
   04151 PI3K-Akt signaling pathway
    448810 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    448810 (MYC)
   04218 Cellular senescence
    448810 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    448810 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    448810 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    448810 (MYC)
   05202 Transcriptional misregulation in cancer
    448810 (MYC)
   05206 MicroRNAs in cancer
    448810 (MYC)
   05205 Proteoglycans in cancer
    448810 (MYC)
   05230 Central carbon metabolism in cancer
    448810 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    448810 (MYC)
   05225 Hepatocellular carcinoma
    448810 (MYC)
   05226 Gastric cancer
    448810 (MYC)
   05216 Thyroid cancer
    448810 (MYC)
   05221 Acute myeloid leukemia
    448810 (MYC)
   05220 Chronic myeloid leukemia
    448810 (MYC)
   05219 Bladder cancer
    448810 (MYC)
   05213 Endometrial cancer
    448810 (MYC)
   05224 Breast cancer
    448810 (MYC)
   05222 Small cell lung cancer
    448810 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    448810 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    448810 (MYC)
   05161 Hepatitis B
    448810 (MYC)
   05160 Hepatitis C
    448810 (MYC)
   05163 Human cytomegalovirus infection
    448810 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    448810 (MYC)
   05169 Epstein-Barr virus infection
    448810 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    448810 (MYC)
   03019 Messenger RNA biogenesis [BR:ssc03019]
    448810 (MYC)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    448810 (MYC)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     448810 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 448810
NCBI-ProteinID: NP_001005154
LinkDB
Position
4
AA seq 452 aa
MDFLRIVENPAAAMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSE
DIWKKFELLPTPPLSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLG
GDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPIPARG
HGGYSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSA
ESSPRGSPEPLALHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGH
SKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPSAKRAKLDSGRVLKQISNNRKCASPRS
SDTEENDKRRTHNVLERQRRNELKRSFFARRDQIPELENNEKAPKVVILKKATAYILSVQ
AEEQKLVSEKDVLRKRREQLKLKLEQLRNSCP
NT seq 1359 nt   +upstreamnt  +downstreamnt
ctggatttccttcggatagtggaaaacccggctgccgcgatgcccctcaacgtcagcttc
accaacaggaactatgacctcgactacgactcggtgcagccttatttctactgcgacgag
gaggagaacttctaccagcagcagcagcagagcgagctgcagccgccggcacccagcgag
gatatctggaagaaattcgagttgctgcccaccccgcccctgtccccgagccgccgctcc
gggctctgctcgccctcgtacgtcgcggtcgcgtccttctcccccaggggagacgatgac
ggcggcggcggcagcttttccacggccgaccagttggagatggtgaccgagctgctggga
ggagacatggtgaaccagagcttcatctgcgaccccgacgacgagaccttcatcaaaaac
attattatccaggactgtatgtggagcggcttctcagccgccgccaagctcgtgtcagag
aagctggcctcctaccaggctgcgcgcaaagacagcggcagcccgattcccgcccgcggg
cacggcggctactccacctccagcttgtacctgcaggacctgagcgccgccgcctccgaa
tgcatcgacccctcggtggtcttcccctacccgctcaacgacagcagctcgcccaagccc
tgcgcctcccccgactccaccgccttctccccgtcctcggactctctgctctcctccgcc
gagtcctccccacggggcagtcccgaacccttggctctccacgaggagacaccacccacc
accagcagcgactctgaggaggaacaagaagatgaggaagaaattgatgttgtttctgtg
gaaaagaggcagccccctgccaaaaggtcggaatcggggtcaccctctgctggaggccac
agcaaacctcctcacagccccctggtccttaagagatgccatgtgtccacgcaccagcac
aattatgcagcgcccccctccaccaggaaggactatccctctgccaagagggctaagttg
gacagtggcagggtcctgaaacagatcagcaacaaccgaaaatgcgccagccccaggtcc
tcggacacggaggagaatgacaagaggcggacacacaatgtcttggaacgccagaggaga
aacgagctgaaacgcagcttttttgcccgtcgagaccagatcccagagttggagaacaat
gaaaaagcccccaaggtagttatccttaaaaaagccacagcttacatcctgtctgtccaa
gcagaggagcaaaagctcgtgtcagaaaaagacgtgctgcggaagaggcgagaacagttg
aaactcaaacttgaacagctacggaactcttgcccataa

DBGET integrated database retrieval system