KEGG   Sus scrofa (pig): 574064Help
Entry
574064            CDS       T01009                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00500  Starch and sucrose metabolism
ssc01100  Metabolic pathways
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04910  Insulin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    574064 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    574064 (GYS1)
   04152 AMPK signaling pathway
    574064 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    574064 (GYS1)
   04922 Glucagon signaling pathway
    574064 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    574064 (GYS1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     574064 (GYS1)
Glycosyltransferases [BR:ssc01003]
 Polysaccharide
  Storage polysaccharide
   574064 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 574064
NCBI-ProteinID: NP_001182437
Ensembl: ENSSSCG00000003154
UniProt: E0X6R2
LinkDB All DBs
Position
6
AA seq 737 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSINSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWETCSIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPPDEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRGSVDTGPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagccgcactttgtccatgtcctcattgccaggactggaagattgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacggtgctgcagacgaaggcgaaggtgaccggggatgaatggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaactgctc
gagcccccgaccccggccctgaagaggaccctggattccataaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgaggggggcccgctggtggtgctcttggacgtgggg
gcctcagcctgggccctggagcgctggaaaggggagctgtgggaaacatgcagcatcggg
gtaccctggtacgaccgcgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacatgtggtcgcacacttccac
gagtggctggcgggcatcggactctgcctgtgccgtgcccggcgactgcctgtggctaca
atcttcaccacccacgccacgctgctggggcgatacctatgtgctggtgctgtggacttc
tacaacaacctggagaatttcaatgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcagcagcccactgtgctcatgtcttcactaccgtgtctcag
attactgccatcgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttctatgggcacttggacttcaacttg
gacaagaccttgtacttctttattgcggggcgctatgagttctccaacaagggggctgac
gttttcctggaggctttggcccggctcaactatctgctcagagtgaacggcagcgagcag
acagtggttgctttcttcatcatgccggcccggaccaacaatttcaatgtggaaaccctt
aagggccaagccgtgcgcaagcagctttgggatacggccaacacggtgaaggagaagttt
gggaggaagctttatgaatccttgctggtgggaagcctcccagacatgaacaagatgctg
gacaaggaggatttcaccatgatgaagagagccatctttgccacgcagcggcagtcgttc
ccccctgtgtgcacccacaatatgctggatgactcctcggaccctatcttgaccactatc
cggagaattggcctcttcaacagtagtgccgacagggtcaaggtaatttttcacccggag
ttcctctcctccacgagccccctgctccccgtggactacgaggaatttgtccgtggctgc
caccttggcgtctttccctcctattacgagccttggggctacacgccagctgaatgcacg
gttatgggtatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcggcttacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagtcggcgg
cagcgcattatccagcggaaccgcaccgagcgcctctccgaccttctggactggaaatac
ctaggccggtactacatgtctgcacgccacatggcactggccaaggcctttccagaacac
ttcacctacgagccccacgaagctgacgcaacccagggctaccgctacccacggccagca
tcagtgccaccatcgccttcgctgtcgcgccattcgagtccacaccagagtgaggatgag
gaggaaccgcgggatggaccacctgatgaagacggcgagcgctatgacgaggacgaggag
gccgccaaggatcggcgcaatatccgcgcccccgagtggcctcgacgcgcctcttgcacc
tcttccactagcgggagcaagcgcggctccgtggacacagggccatccagctcactcagc
acccccagcgagcccctcagccccgccagctccctgggagaggagcgcaactaa

DBGET integrated database retrieval system