KEGG   Sus scrofa (pig): 613130
Entry
613130            CDS       T01009                                 

Gene name
FCGR1A
Definition
(RefSeq) high affinity immunoglobulin gamma Fc receptor I precursor
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04145  Phagosome
ssc04380  Osteoclast differentiation
ssc04640  Hematopoietic cell lineage
ssc04666  Fc gamma R-mediated phagocytosis
ssc05140  Leishmaniasis
ssc05150  Staphylococcus aureus infection
ssc05152  Tuberculosis
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
ssc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    613130 (FCGR1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    613130 (FCGR1A)
   04666 Fc gamma R-mediated phagocytosis
    613130 (FCGR1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    613130 (FCGR1A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    613130 (FCGR1A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    613130 (FCGR1A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    613130 (FCGR1A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    613130 (FCGR1A)
   05152 Tuberculosis
    613130 (FCGR1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    613130 (FCGR1A)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    613130 (FCGR1A)
CD molecules [BR:ssc04090]
 Proteins
  613130 (FCGR1A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 I-set C2-set Receptor_2B4
Other DBs
NCBI-GeneID: 613130
NCBI-ProteinID: NP_001028183
Ensembl: ENSSSCG00000006678
Vega: OTTSUSG00000001972
UniProt: Q461Q0
LinkDB
Position
4
AA seq 346 aa
MWLLIILLLCVPTGGQMDQAKAVITLQPPWVSVFQEENVTLQCEGPHLPGDSSTQWFLNG
TAIETLTPRYRIAAAGINDSGEYRCQTGLSVPSDPVQLEVHKDWLLLQVSSRVFTEGEPL
ALRCHGWRNKLMYNILFYQNGKTFKFSPRNSEFTILKTNLSHNGIYHCSGMRVHRYTSAG
VSITIKELFPAPVLRASLSFPILEGNLVNLSCETKLLPQRPGLQLYFSFFMGSKTLMSRN
TSSSYQMLTAKKEDSGLYWCEAATEDGKVIKRSTELELQVLGPQPPTPVWFHVVFYLAVG
SVFLMDTVFYVIIQKQLQRKKKWDLEISLDSGHGKKVTSYLPKINI
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtggctcttaataattctgctcctttgcgttccaactggtgggcaaatggaccaggca
aaggcagtgatcaccttgcagcctccgtgggtcagtgtgttccaagaagaaaacgtaact
ttacaatgtgagggaccccatctgcctggggacagctctacacagtggtttctcaatggc
acagccattgagaccttgacccccagatacagaattgctgctgctggtatcaatgacagt
ggtgaatacaggtgccagacaggtctctcagtgccaagtgaccctgtacagctggaagtc
cacaaggattggctactactccaggtctcgagcagagtctttactgaaggggaacctctg
gccttgaggtgtcatggatggaggaataaactgatgtacaacatccttttctaccaaaat
ggcaaaacctttaagttttctcctcggaattctgaattcaccattctgaaaaccaacttg
agtcacaatggcatctatcattgctcaggcatgagagtgcatcgatacacatctgcagga
gtatctatcactataaaagagctatttccagctccagtgctgagagcatccttgtcattc
cccatcctagaggggaacctggtcaacttgagctgtgaaacaaagttgctcccacagagg
cctggcttgcagctttacttctccttcttcatgggaagcaagaccctgatgagcaggaac
acgtcctctagctaccagatgctaactgctaaaaaagaagactctgggttatactggtgt
gaggcggccacagaagatggaaaggtcatcaagcgcagcactgagttggagcttcaggtg
cttggcccccagccaccaactcctgtctggtttcatgtcgttttctatctggcagtaggg
tctgtatttttgatggatactgttttctatgtgataatacagaagcaactacaaagaaag
aaaaagtgggatttggaaatctctttggactctggtcacgggaagaaggtaacttcctac
cttccaaagataaatatttag

DBGET integrated database retrieval system