KEGG   Sus scrofa (pig): 654325
Entry
654325            CDS       T01009                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9 precursor
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04657  IL-17 signaling pathway
ssc04668  TNF signaling pathway
ssc04670  Leukocyte transendothelial migration
ssc04915  Estrogen signaling pathway
ssc04926  Relaxin signaling pathway
ssc05161  Hepatitis B
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05215  Prostate cancer
ssc05219  Bladder cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    654325 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    654325 (MMP9)
   04670 Leukocyte transendothelial migration
    654325 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    654325 (MMP9)
   04926 Relaxin signaling pathway
    654325 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    654325 (MMP9)
   05202 Transcriptional misregulation in cancer
    654325 (MMP9)
   05206 MicroRNAs in cancer
    654325 (MMP9)
   05205 Proteoglycans in cancer
    654325 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    654325 (MMP9)
   05215 Prostate cancer
    654325 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    654325 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    654325 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    654325 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    654325 (MMP9)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     654325 (MMP9)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M10
   654325 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 DUF4953 Reprolysin_3 DUF5771 Peptidase_M66
Other DBs
NCBI-GeneID: 654325
NCBI-ProteinID: NP_001033093
Ensembl: ENSSSCG00000007436
UniProt: Q2VI03
LinkDB
Position
17
AA seq 708 aa
MSPWQPLVLVLLVLGCSAAPKPRQPTFVVFPGDLRTNLIDRQLAEEYLYRYGYTQVAEMT
DRKQSLEPALKLLQQRLSLPQTGELDTTTLNAMRAPRCGVPDLGKFQTFEGDLKWHHHDM
TYWIQNYSEDLSRDVIDDAFVRAFSLWSEATPLNCTRVYGPNADIVIQFGVKEHGDGYPF
DGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNAKGAACHFPFTFEGRSY
SACTTDGRSDDMLWCSTTADYDTDRQFGFCPSERLFTRDGNADGKPCVFPFTFEGRSYSS
CTTDGRSDGYRWCGTTANYDQDKLYGFCPTRADSTVTGGNSAGDLCVFPFTFLGKEYSAC
TREGRSDGHLWCATTSNFDKDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSTVPEALMYP
MYSFTEEHPLHEDDVRGIQYLYGSRPKPEPRPPTTTTAEPQSTVPPTVCVTGPPTTRPSE
RSTAGPTGPPSAGPTGPPTAGPSAAPTVSLGPGEDICNVDIFDAIAEIRNRLHFFKDGKY
WRLSEGKEHRVQGPFLIKDRWPALPHKLDSAFEEPLSKKIFFFSGRQVWVYTGASVLGPR
RLDKLGLGPEVARVTGALPREAGKVLLFSQQNFWRFDVKTQKVDSRSATRVDQMFPGVPL
NTHDIFQYQEKAYFCQARFFWRVSSRNEVNQVDYVGYVTFDLLKCPED
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgagcccctggcagcccttggtcctggtgctcctggtgctgggctgctctgccgccccc
aaaccacgccagcccacctttgtggtcttcccgggagacctacgaaccaatcttattgac
aggcagctggcagaggaatatctgtaccgctatggctacactcaagtggccgagatgacc
gacagaaagcagtccctggaaccggctctaaagcttctccagcagcgcctgtccctgccg
cagactggcgagctggacaccaccaccctgaatgccatgcgtgccccgcgctgcggcgtt
ccggacctgggcaaattccagacctttgagggcgacctcaagtggcaccaccacgacatg
acctactggatccaaaactactcggaagacttgtcgcgcgatgtgattgacgacgccttt
gtccgcgccttttcgctctggagcgaggcgacgccgctcaattgcactcgcgtatacggc
cccaacgccgacatcgttatccagtttggtgttaaggagcacggagatgggtatcccttc
gatgggaaggacgggctcctggcacacgccttccctcctggcccgggcattcaaggagac
gcccacttcgacgatgaagagttgtggtctctgggcaaaggcgtcgtggttccgacctac
ttcggaaacgcaaaaggcgcagcctgccacttccccttcaccttcgagggccgctcctat
tccgcctgcaccacggacggccgctccgacgacatgctctggtgcagcaccacggccgac
tatgacaccgaccgccagtttggcttctgccctagcgagagactcttcactcgggacggt
aacgcggacggcaagccctgcgtgtttccattcaccttcgagggccgctcctactcctcc
tgcaccaccgacggccgctcagacggctaccgctggtgcggcaccactgccaactacgac
caggacaagctttatggcttctgccctacccgagctgactcgacggtgacgggaggcaac
tcggcgggggacctgtgcgtcttccccttcaccttcctgggcaaggagtactcggcctgc
accagagagggccgcagtgatgggcacctctggtgtgccaccacctcgaacttcgacaag
gacaagaagtggggcttctgcccggaccaaggctacagcctgttccttgtggcggcgcac
gagttcggccacgcattgggcttagatcactcaaccgtgccagaggcgctcatgtacccc
atgtacagcttcactgaggagcaccccctgcatgaggacgatgtgcggggcatccagtat
ctgtatggttctcgccctaaacctgaaccccggcctccaaccaccaccacagctgaaccc
cagtccaccgttccccccacggtctgcgtcaccgggcctcccactacccgcccctctgag
cgctccactgctggccccacaggccctccttcagctggccccacgggtcctcccactgct
ggcccttctgcagcccctacggtgtccttggggccaggggaggacatctgcaatgtggac
atcttcgatgccatcgcggagatccggaatcgcctacatttcttcaaggatgggaagtac
tggcgactctctgagggcaaggaacatcgggtgcagggccccttccttatcaaggacagg
tggcctgcgcttccccacaagctggactctgcctttgaggagccgctcagcaagaagatt
ttcttcttctctggacgccaagtgtgggtgtacacaggcgcgtcggtactaggcccgagg
cgtctggataagttgggcctgggcccggaggtggcccgcgtcacaggggccctcccgcgc
gaggcgggtaaggtgctgctgttcagccagcagaacttctggaggttcgacgtgaagacg
cagaaggtggattcccggagcgccacccgtgtggaccagatgttccccggggtgcccttg
aacacacacgacatcttccagtaccaagagaaagcttacttctgccaggcccgcttcttc
tggcgtgtgagttcccggaacgaggtgaatcaggtggactatgtgggctacgtgaccttc
gacctcctgaagtgccccgaggactag

DBGET integrated database retrieval system