KEGG   Sus scrofa (pig): 654328
Entry
654328            CDS       T01009                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04360  Axon guidance
ssc04510  Focal adhesion
ssc04520  Adherens junction
ssc05100  Bacterial invasion of epithelial cells
ssc05144  Malaria
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05211  Renal cell carcinoma
ssc05218  Melanoma
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    654328 (MET)
   04014 Ras signaling pathway
    654328 (MET)
   04015 Rap1 signaling pathway
    654328 (MET)
   04020 Calcium signaling pathway
    654328 (MET)
   04151 PI3K-Akt signaling pathway
    654328 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    654328 (MET)
   04520 Adherens junction
    654328 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    654328 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    654328 (MET)
   05202 Transcriptional misregulation in cancer
    654328 (MET)
   05206 MicroRNAs in cancer
    654328 (MET)
   05205 Proteoglycans in cancer
    654328 (MET)
   05230 Central carbon metabolism in cancer
    654328 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    654328 (MET)
   05226 Gastric cancer
    654328 (MET)
   05218 Melanoma
    654328 (MET)
   05211 Renal cell carcinoma
    654328 (MET)
   05223 Non-small cell lung cancer
    654328 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    654328 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    654328 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    654328 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    654328 (MET)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     654328 (MET)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  MET family
   654328 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Kinase-like Pkinase_fungal Linker_histone Ninjurin
Other DBs
NCBI-GeneID: 654328
NCBI-ProteinID: NP_001033097
Ensembl: ENSSSCG00000016633 ENSSSCG00000024351
Vega: OTTSUSG00000000914
UniProt: Q2QLE0
LinkDB
Position
18
AA seq 1381 aa
MKAPAVLAPGILVLLFTLVQKSKGECKEALVKSTMNLNMQYQLPNFTAETPIQNVVLHKH
HIYLGALNYIYVLNDIDLRKVAEYKTGPVLEHPDCFPCQDCSHKANLSGGIWRDNINMAL
LVDTYYDDQLISCGSVHRGTCQRHVLPPDNIADIKSEVHCMYSPQVDEEPSQCPDCVVSA
LGTKVLLSEKDRFINFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGTQLAKQIGANLNDDILYGVFAQSKPDSAEPMNR
SAVCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQRIDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRPGLSTPHVNF
HLDSHPVSPEVIVEPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCGW
CQDKCVQLEECPSGTWTQEICLPTVYKVFPTSAPLEGGTTLTICGWDFGFRRNNKFDLRK
TKVLLGNESCTLTLSESTTNTLKCTVGPAMNEHFNMSIVISNGRGTTQYRTFSYVDPVIT
NISPSFGPKTGGTLLTLTGMHLNSGNSRHISIGGKTCTLKSVSDSVLECYTPAQTTPTEF
PIKLKIDLANREINSFTYREDPIVYEIHPTKSFISGGSTITGVGRNLNSVSVLRMVINVH
EAERNFTVACQHHSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNPV
FKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHSHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIVGVVSISIILLLLLGLFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSSEPVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPRAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDGEGD
T
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgaaggcccctgctgtgcttgcacctggcatccttgtgcttctgtttaccttggtgcag
aagagcaagggagagtgtaaagaggcactggtaaagtccacgatgaatttgaacatgcaa
tatcagcttcctaacttcactgcggaaacacccattcagaatgtcgttttacacaagcat
cacatttacctgggtgcccttaactacatttatgttttaaatgacatagaccttcggaag
gttgctgagtacaaaactgggcccgtgctggaacacccagattgtttcccatgtcaggac
tgcagccacaaagccaatttatcaggtggcatttggagagataacatcaacatggctctg
cttgttgacacgtattatgatgaccaactcattagctgcggcagtgtccacagagggacc
tgccagcggcatgtccttccacctgataatatcgctgacatcaagtcagaggttcactgc
atgtactccccacaggtagatgaagagcccagccagtgtcctgactgtgtggtgagtgcg
ctgggaaccaaagtcctgctgtctgaaaaggaccggttcatcaacttcttcgtgggtaat
accataaattcttcttaccttccggatcattcattgcattcaatatcagtgagaaggcta
aaggaaacgcaagatggttttaagtttttgacagaccagtcctatattgatgttctacct
gagttccgagattcctaccccattaagtatgtccatgcctttgaaagcaaccattttatt
tactttttgacagtccaacgggaaactctcgacgctcagacttttcacacaagaataatc
aggttctgttctgtagactctggattgcattcctacatggaaatgcctctggagtgtatt
ctcacagaaaagagaagaaagagatccacaagggaggaagtgttcaatattctccaagct
gcatatgtcagtaagcctgggactcagctcgctaagcaaataggtgccaacctgaatgat
gacattctctatggggtatttgcacaaagcaagccagattctgccgaaccaatgaatcgc
tctgccgtctgtgcattccctgtgaaatatgtcaatgaattcttcaacaagattgtcaac
aaaaacaatgtgagatgtctccagcatttttatggccccaaccatgaacactgcttcaac
aggacacttttgagaaattcatcaggctgtgaagtgcgcagtgatgaatatcgaacagag
tttaccacagctttgcagcgaattgacttattcatgggccagttcaaccaagtcctctta
acatccatatccaccttcattaaaggagacctcaccatcgctaacctcgggacgtcagag
ggtcgattcatgcaggttgtggtttctcgaccaggattgtcaacccctcacgtgaatttt
cacctggattcccaccctgtatctccagaagtgatcgtggagccactaaaccaaaatggc
tataccctggtagtcactgggaagaagatcaccaagatcccgctgaacggcttgggctgt
gaacatttccagtcctgcagtcagtgcctctctgcccctccctttgtacagtgtggctgg
tgccaggataaatgtgtgcaattggaggaatgccccagtgggacatggactcaagagatc
tgtctgcctacagtctacaaggttttccctactagtgccccccttgaaggagggacaacg
ctgaccatatgtggctgggactttggattcaggagaaataataaatttgacttaaggaaa
accaaagttctccttgggaatgagagctgtaccttgaccttaagtgagagcacgacaaac
acgttgaaatgcacagttggtcctgcaatgaatgaacatttcaatatgtccatagttatt
tcaaatggtcgagggacaacacaatataggacgttttcctatgtggatcctgtaataaca
aatatttctccaagttttggtcctaaaactggtggtactttacttacattaactggaatg
cacctaaacagtgggaactctagacacatttcaattggtggaaaaacgtgtactttgaaa
agtgtgtcagatagtgttcttgaatgttataccccagcccaaaccactccaactgaattc
cctattaagttgaaaattgacttagccaaccgagagataaacagcttcacttaccgggaa
gaccccattgtctatgaaatacatcccaccaaatcttttattagtggagggagcacaata
acaggtgttggaagaaacctgaattcagttagtgtcctgaggatggtaataaatgtgcat
gaagcagaaagaaattttacagtggcatgccagcatcactctaattcagagataatctgc
tgtacaactccttcactacaacagctgaacctacaactccccctgaaaaccaaggcattt
ttcatgttagatgggattcattccaaatactttgatctcatttatgtacataaccctgtg
tttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaacgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agttgtgagaatatacattcacattctgaagccgttttatgtacagtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaactgtcctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgttggtgttgtctca
atatcaataatactcttattactgctcgggcttttcctgtggctgaaaaagagaaagcaa
attaaagatctaggcagtgaactagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaagtgaacct
gtagactaccgagctacttttccagaagaccagttccctaactcatctcagaatggatca
tgcagacaagtgcagtatcctctgacagacctatcccccatcctaactagtggagactct
gatatatctagtccattactgcaaaataccgtccacattgacctcagtgctctaaatcca
gagctggtccaggcagttcagcatgtagtgattgggccaagcagcctgattgtgcatttc
aatgaagtcataggaagaggacattttgggtgtgtataccatgggactttattggataat
gatgataagaaaattcactgtgctgtgaaatccttgaatagaatcactgacataggagaa
gtttcccaatttctgactgagggaatcatcatgaaagattttagtcatcccaatgttctc
tcgctcttgggaatctgccttcgaagtgaggggtctccactggtggtcctaccatacatg
aaacatggggatcttcgaaatttcattagaaatgagactcataacccaactgtaaaagat
cttattggctttggccttcaagtngccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaaggtt
gctgattttggacttgccagggatgtgtatgataaagaatactatagtgtacacaacaaa
acaggtgcaaaactgccagtgaagtggatggctttagaaagcctgcaaactcagaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggaactgatgacaagagga
gcaccaccttatcctgacgtcaacacctttgatataacagtgtacttgttgcaaggcaga
aggctcctacaacctgaatactgcccagatcccttgtacgaagtgatgctgaaatgctgg
catcctagagctgaacttcgcccatccttttctgaactggtctccaggatatcagctatc
ttctctactttcattggggagcactatgtccacgtgaatgctacttacgtgaatgtcaaa
tgtgttgctccatatccttctcttttgtcatcacaagataatgttgatggcgagggggac
acatga

DBGET integrated database retrieval system