KEGG   Sus scrofa (pig): 733621
Entry
733621            CDS       T01009                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04062  Chemokine signaling pathway
ssc04068  FoxO signaling pathway
ssc04137  Mitophagy - animal
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04722  Neurotrophin signaling pathway
ssc04917  Prolactin signaling pathway
ssc05213  Endometrial cancer
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    733621 (FOXO3)
   04151 PI3K-Akt signaling pathway
    733621 (FOXO3)
   04152 AMPK signaling pathway
    733621 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    733621 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    733621 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    733621 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    733621 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    733621 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    733621 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    733621 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    733621 (FOXO3)
   05223 Non-small cell lung cancer
    733621 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    733621 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    733621 (FOXO3)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    733621 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 733621
NCBI-ProteinID: NP_001129431
Ensembl: ENSSSCG00000004387
UniProt: B5UA80
LinkDB
Position
1
AA seq 672 aa
MAEAPASPVPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGEAAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGGPLGSGLLLEDSARLLAPGGQEPGSGPASAAGALSG
GTQTPLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLADNLMDDLLDNIALPSSQPSPPGGLMQRSSSFPYTTKGS
GLGSPTSSFSSTVFGPSSLNSLRQAPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRSDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSASSMGLSDSSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGSFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcgccggcctccccggtcccgctctctccgctcgaagtggagctggacccg
gagttcgagccccagagccgtccgcgctcctgtacgtggcccctgcagaggccggagctc
caggggagcccggccaagccctcgggggaggcggccgctgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggcggcggtagggccggctcggccatggcgatcggc
ggcggcgggggcggcccgctgggctctgggctgctcctggaggactcggccaggctgctg
gctcccggagggcaggaacccgggtccggcccagcctccgcggcgggcgcgctgagcgga
gggacgcagacgccgctgcagcctcagcagccactgccaccgccgcagccgggggcggct
gggggctccgggcagccgaggaaatgctcctcgcggcggaacgcctgggggaacctgtcc
tacgccgatctgatcactcgcgccatcgagagttccccggacaaacggctcactctgtcc
cagatctatgagtggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaac
agttctgccggctggaagaactctatccggcacaacctgtcactgcacagccggttcatg
cgagtccagaacgaggggaccggcaagagctcttggtggatcatcaaccctgatggggga
aagagcgggaaggcgccccggcggcgggctgtctccatggacaacagcaacaagtacacc
aagagccgcggccgggcagccaagaagaaggccgccctgcagacagcccctgagtcggca
gacgacagtccctcccagctctccaagtggcccggcagccccacgtcccgcagcagtgat
gagctggacgcctggactgacttccgctcgcgcaccaattccaacgccagcacggtcagc
ggccgcctgtcccccatcctggccagcacagagttggatgacgtccaggatgacgacgcg
ccgctctcccccatgctctacagcagctcggccagcctgtccccctcggtcagtaagccc
tgcaccgtggagctgccccggctgaccgacatggccggaaccatgaatctcaatgacggg
ctggctgacaacctcatggacgacctgctggacaacatcgcgctgccctcgtcccagcca
tcgccccccggggggctcatgcagcgcagctctagcttcccctacaccaccaagggctcc
ggcctgggctcgcccaccagctccttcagcagcacagtgtttggaccctcgtctctgaac
tcgctgcgccaggcgcccatgcagaccatccaagagaacaagccagccaccttctcttcc
atgtcgcactacggcaaccagacactccaggacctgctcacgtcggactcactcagccac
agcgatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtcc
gcccagaactcccgccggaacgtgatgcttcgcagtgacccaatgatgtcctttgccgcc
cagcctaaccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctctcggtggcagccgtgccttgtcgaattccgccagcagcatgggcttgagcgac
tcaagcagcctcgggtcagccaaacaccagcagcagtctcctgtcagccagtctatgcaa
accctctcggactccctctcaggctcctccttgtactcaacgagtgcgaaccttcccgtc
atgggccacgagaagttccccagcgacttggacctggacatgttcaacgggagcttggaa
tgtgacatggagtccattatccgtagcgaactcatggatgctgacgggttggattttaac
tttgattccctcatctccacacagaacgttgttggtttgaacgtggggagcttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system