KEGG   Sus scrofa (pig): 733648
Entry
733648            CDS       T01009                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04217  Necroptosis
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04630  JAK-STAT signaling pathway
ssc04659  Th17 cell differentiation
ssc04917  Prolactin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04931  Insulin resistance
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc05145  Toxoplasmosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05212  Pancreatic cancer
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    733648 (STAT3)
   04066 HIF-1 signaling pathway
    733648 (STAT3)
   04068 FoxO signaling pathway
    733648 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    733648 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    733648 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    733648 (STAT3)
   04062 Chemokine signaling pathway
    733648 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    733648 (STAT3)
   04917 Prolactin signaling pathway
    733648 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    733648 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    733648 (STAT3)
   05206 MicroRNAs in cancer
    733648 (STAT3)
   05205 Proteoglycans in cancer
    733648 (STAT3)
   05203 Viral carcinogenesis
    733648 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    733648 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    733648 (STAT3)
   05221 Acute myeloid leukemia
    733648 (STAT3)
   05223 Non-small cell lung cancer
    733648 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    733648 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    733648 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    733648 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    733648 (STAT3)
   05161 Hepatitis B
    733648 (STAT3)
   05160 Hepatitis C
    733648 (STAT3)
   05163 Human cytomegalovirus infection
    733648 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    733648 (STAT3)
   05169 Epstein-Barr virus infection
    733648 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    733648 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    733648 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    733648 (STAT3)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    733648 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 733648
NCBI-ProteinID: NP_001038045
Ensembl: ENSSSCG00000017403
UniProt: Q19S50 E7CR02
LinkDB
Position
12
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLSTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELNSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctggacacacggtacctggagcagcttcatcag
ctgtacagcgacagcttcccgatggagctccggcagtttctggccccttggattgagagt
caagattgggcatatgcagccagcaaagaatcccacgccactttggtgtttcataatctc
ttgggtgaaattgaccagcagtatagccgcttcctgcaggagtccaatgttctctatcag
cacaacctgcgaagaatcaagcagttccttcagagcagatatcttgagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctcctccagactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgctgtggtgacagagaag
cagcagatgctggagcagcaccttcaggatgttcgcaagcgtgtccaggatctggaacag
aaaatgaaagtggtggagaatctccaggatgactttgatttcaactacaaaaccctcaag
agtcaaggagatatgcaagacctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagctggagcagatgctcactgcgctggaccagatgcggcgaagcatcgtgagtgag
ttggcggggcttttgtcagctatggagtatgtgcagaaaactctcacggatgaagagctg
gctgactggaagaggcggcagcagattgcgtgcattggaggccctcccaacatctgcctg
gatcggctagaaaactggataacctcattagcagaatctcaacttcagacccgccaacaa
attaagaaactagaggagctgcagcagaaagtgagctacaaaggggaccccattgtacag
caccggcccatgctggaggagagaatcgtggagctgttcagaaacttgatgaaaagtgcc
ttcgtggtggagcgacagccctgcatgcctatgcaccctgaccggccattagtcatcaag
accggtgtccagtttacaacgaaagtcagattgctggtcaaattccctgagctaaactat
cagcttaaaattaaagtgtgcattgacaaagactccggggacgtcgcggctctcagagga
tcccggaaatttaacatcctgggcaccaacacgaaagtgatgaatatggaagagtccaac
aacggcagcctctccgcagagttcaaacacctgaccctgagagagcagagatgtgggaac
gggggccgagccaattgcgacgcctccctcattgtgaccgaggagctgcacctgatcacc
tttgagaccgaggtgtatcatcaaggcctcaagattgacctggagacccactccttgcca
gtcgtggtcatctccaacatctgtcagatgcccaacgcctgggcctccatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccgatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcttccaccaccaagcgagggctg
agcatcgagcagttgagcacactggcagagaaactcctaggacctggtgtgaactattca
gggtgtcagatcacgtgggctaagttttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaatatcattgaccttgtgaaaaagtacatcctggccctttgg
aatgaagggtacataatgggctttatcagtaaggagagggagcgggccatcttgagcacc
aagcccccaggcaccttcctgctgagattcagtgaaagcagcaaagaaggaggagtcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtcggtggaaccgtac
accaagcagcagctcaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgctaccaacatccttgtgtctccgctggtctacctctaccctgacattccaaaggaa
gaggcgtttggaaagtattgtcggccagagagccaggagcatcccgaagctgacccaggt
agtgctgccccatacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgagccctcagcaggagggcagtttgagtccctcaccttcgacatggag
ctgaactcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system