KEGG   Sus scrofa (pig): 733685Help
Entry
733685            CDS       T01009                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial precursor
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00053  Ascorbate and aldarate metabolism
ssc00071  Fatty acid degradation
ssc00280  Valine, leucine and isoleucine degradation
ssc00310  Lysine degradation
ssc00330  Arginine and proline metabolism
ssc00340  Histidine metabolism
ssc00380  Tryptophan metabolism
ssc00410  beta-Alanine metabolism
ssc00561  Glycerolipid metabolism
ssc00620  Pyruvate metabolism
ssc01100  Metabolic pathways
Module
ssc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    733685 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    733685 (ALDH2)
   00620 Pyruvate metabolism
    733685 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    733685 (ALDH2)
   00561 Glycerolipid metabolism
    733685 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    733685 (ALDH2)
   00310 Lysine degradation
    733685 (ALDH2)
   00330 Arginine and proline metabolism
    733685 (ALDH2)
   00340 Histidine metabolism
    733685 (ALDH2)
   00380 Tryptophan metabolism
    733685 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    733685 (ALDH2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     733685 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 733685
NCBI-ProteinID: NP_001038076
Ensembl: ENSSSCG00000009889
UniProt: Q2XQV4
LinkDB All DBs
Position
14
AA seq 521 aa AA seqDB search
MLRPAALAAARLVLRQGRRLLSAAPTQAVPAPNQQPEIFYNQIFINNEWHDAISKKTFPT
VNPSTGDVICHVAEGDKEDVDRAVEAARAAFQLGSPWRRLDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTLPIDGDYFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVSEQTPLTALYVANLIKEAGFPPGVVN
IVPGYGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARARSRVVGNPFDSRT
EQGPQIDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgccctgctgcgcttgccgccgcccgcctcgtgctccgccagggccgccgccta
ttatcggccgcccctacccaggcggtgccggcccccaaccagcagcccgagatcttctac
aaccagatcttcataaacaatgagtggcatgatgctatcagcaagaaaacattccccacc
gtcaatccatccactggggatgtcatctgtcatgtagctgaaggagacaaggaagatgtg
gacagggcagtggaagctgcccgggctgcattccagctgggctcaccctggcgtcgcctg
gatgcatctgacaggggccggctgctgaaccgcctggccgatttgattgagcgggaccgg
acctacctagcggcactggagaccctggacaacggcaagccctatgtcatctcttacctg
gtagatttggacatggtcctcaagtgtctccgttactatgctggctgggctgataagtac
catggtaaaacccttcccatcgacggggactacttcagctacactcgccatgagcctgtg
ggagtgtgtgggcagatcatcccgtggaacttcccgctcttgatgcaagcgtggaaactg
ggcccagccttggcgactggaaacgtggttgtgatgaaggtttctgagcagactccactc
actgccctctatgtggccaacttgattaaggaggccggctttcctcctggcgtggtcaat
attgttcctggatatggcccaacagccggggctgccatcgcctctcatgaggatgtggac
aaagtggccttcacaggctccactgaggttggccacctcatccaggttgctgcagggaag
agtaacctcaagagagtgaccctggagctaggaggaaagagccccaatatcatcatgtca
gatgctgatatggactgggctgtggagcaggcccacttcgccctgttcttcaaccagggc
cagtgctgctgtgcgggctcccggacctttgtgcaggaggacatttatgctgagtttgtg
gagcggagtgttgcccgggccaggtctcgtgtggtggggaacccttttgacagccggact
gagcaggggccgcagatagatgaaactcagtttaagaagattcttggctacatcaagtct
gggaaggaggaaggggcgaaactgctctgcggtggaggggcggctgctgaccgtggctac
ttcatccagcccaccgtgtttggagatgtgcaagatggcatgaccattgcaaaggaggag
atctttgggccagtgatgcagattctcaagttcaagaccatagaggaagtcattgggaga
gccaacaattccaagtacgggctggccgcagctgtcttcacaaaggacttagacaaggcc
aattatctgtctcaagcccttcaggctggcaccgtgtgggtcaactgctatgacgtgttt
ggagcccagtcaccgtttggtggctacaaactgtctgggagtggccgggagctgggagag
tatgggctgcaggcatacacggaagtaaaaactgtcacagtcaaagttcctcagaagaac
tcataa

DBGET integrated database retrieval system