KEGG   Sus scrofa (pig): 780433Help
Entry
780433            CDS       T01009                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00020  Citrate cycle (TCA cycle)
ssc00190  Oxidative phosphorylation
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc04714  Thermogenesis
ssc04932  Non-alcoholic fatty liver disease (NAFLD)
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05016  Huntington disease
Module
ssc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    780433 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    780433 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    780433 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    780433 (SDHA)
   05012 Parkinson disease
    780433 (SDHA)
   05016 Huntington disease
    780433 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    780433 (SDHA)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     780433 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 780433
NCBI-ProteinID: XP_020932589
LinkDB All DBs
Structure
PDB: 

Position
16
AA seq 665 aa AA seqDB search
MSGVRAVSRLLRARRLALTWAQQPAASPIGARSFHFTVDGNKRSSAKVSDAISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRARNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAVRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPSIKPNAGEESVMNLDKLRFANGTIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKI
LRLYGDLQHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKE
RVDEYDYSKPIQGQQKKPFQEHWRKHTLSYVDVKTGKVSLEYRPVIDKTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccgggctgtgtcacggctgctgcgcgcccggcgcctggcgctgacctgg
gcgcagcagccagcagcatcacccataggagcccgcagctttcacttcactgttgatggc
aataagaggtcgtcggccaaagtttcagatgcgatttctacgcagtacccagtagtggat
catgaatttgacgcagtggtggttggtgccggaggggcaggcctgcgagctgcgtttggt
ctctctgaggccgggtttaacacagcctgcgttacgaagctctttcccaccagatcacac
actgttgcagcccagggaggcatcaatgctgccctggggaacatggaggaggacaactgg
aggtggcatttctacgacactgtgaagggctccgactggctgggggaccaggacgccatc
cactacatgacagagcaggcccccgcctccgtggtagagctagagaattacggcatgccg
ttcagcagaaccgaagatggcaagatctaccagcgcgcctttggcggacagagcctcaag
ttcgggaagggcgggcaggcccatcggtgctgctgcgtggccgaccgcactggccactca
ctgctgcacacgttgtacggaaggtctctgcggtacgataccagctattttgtggagtat
tttgccttggatctcctgatggaaaacggggagtgtcgtggagtcatcgccctgtgcatc
gaagacgggtccatccaccgcatcagagccaggaacactgttgtcgctaccggaggctac
ggccgcacgtacttcagctgcacgtccgcccacaccagcaccggagacggcaccgccatg
gtcaccagggcgggccttccctgccaggacctggagttcgtgcagttccaccctacaggc
atctacggcgctggctgtctcatcacagaggggtgccgcggagagggaggcatccttatc
aacagccagggtgagaggttcatggagcgctacgcccccgtcgcaaaggacctggcatcc
agggacgtcgtgtcccggtccatgactctggaaatccgggaaggaagaggctgcggcccc
gagaaggaccatgtgtacctgcagctgcaccacctcccccctgagcagctggcggtgcgc
ctgcctggcatctcggagacggccatgatcttcgcgggtgtggacgtcaccaaggagccg
atccccgtgctccccaccgtgcactataacatgggcggcatccccaccaactacaagggg
caggttctgaggcacgtcaacggccaggaccaggtggtgcctgggctgtacgcctgcgga
gaggctgcctgtgcctcggtgcacggtgccaaccgcctgggggcaaactcgctcctggac
ctcgttgtcttcggccgggcatgtgccctgagcatcgcggagtcctgcaggccaggagat
aaagttccctcaattaaaccaaatgctggggaggaatcggtcatgaatcttgacaaactg
agatttgcgaacggaaccataaggacatcggagctgcggctcagcatgcagaagtcgatg
cagagccacgccgcagtgttccgcgtgggcagcgtgttacaggaaggctgtgagaagatc
ctccggctctacggagacttgcagcacctgaagacgtttgacagaggaatggtctggaac
actgacctggtggagaccctggagctgcagaacctgatgctttgcgccctgcagaccatt
tatggggcagaggcccggaaggagtcccgtggcgctcacgccagggaggatttcaaggag
cgggttgacgagtacgattactccaagcccatccaggggcagcagaagaagccgttccag
gagcactggcggaagcacacgctttcctatgtcgatgtcaagaccgggaaggtctctctg
gaatacagacccgtaatcgacaaaactttgaatgaagctgactgtgccactgtcccccca
gccatccgctcctactga

DBGET integrated database retrieval system